BLASTX nr result
ID: Papaver23_contig00022039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00022039 (1220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279240.1| PREDICTED: endoplasmic reticulum metallopept... 56 2e-07 emb|CAN74144.1| hypothetical protein VITISV_011748 [Vitis vinifera] 56 2e-07 >ref|XP_002279240.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Vitis vinifera] gi|297738431|emb|CBI27632.3| unnamed protein product [Vitis vinifera] Length = 873 Score = 56.2 bits (134), Expect(3) = 2e-07 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = -3 Query: 258 SGGFKLLAEYATEVVEELQISSKLSLGKFQELDWSTWMVVFPINLLFSGSLEFPDRGD 85 S L E+A EV +EL + S+LS ++ TWMV+FP++ LFSGSL+FP R D Sbjct: 678 SNSLPFLFEHAPEVAKELNMGSELSFKATKDSPRQTWMVLFPVSFLFSGSLKFPARSD 735 Score = 23.9 bits (50), Expect(3) = 2e-07 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 301 TADGRSVAGSSYDF 260 TAD V GSSYDF Sbjct: 660 TADASRVVGSSYDF 673 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 263 FSVVDSNFLP 234 FSVVDSN LP Sbjct: 673 FSVVDSNSLP 682 >emb|CAN74144.1| hypothetical protein VITISV_011748 [Vitis vinifera] Length = 829 Score = 56.2 bits (134), Expect(3) = 2e-07 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = -3 Query: 258 SGGFKLLAEYATEVVEELQISSKLSLGKFQELDWSTWMVVFPINLLFSGSLEFPDRGD 85 S L E+A EV +EL + S+LS ++ TWMV+FP++ LFSGSL+FP R D Sbjct: 633 SNSLPFLFEHAPEVAKELNMGSELSFKATKDSPRQTWMVLFPVSFLFSGSLKFPARSD 690 Score = 23.9 bits (50), Expect(3) = 2e-07 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 301 TADGRSVAGSSYDF 260 TAD V GSSYDF Sbjct: 615 TADASRVVGSSYDF 628 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 263 FSVVDSNFLP 234 FSVVDSN LP Sbjct: 628 FSVVDSNSLP 637