BLASTX nr result
ID: Papaver23_contig00022037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00022037 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311175.1| GRAS family transcription factor [Populus tr... 69 4e-10 dbj|BAC77269.2| SCARECROW-like protein [Lilium longiflorum] 69 5e-10 ref|XP_002267055.1| PREDICTED: scarecrow-like protein 9 [Vitis v... 68 9e-10 gb|AFH54552.1| GRAS family protein, partial [Dimocarpus longan] 67 1e-09 ref|XP_003522103.1| PREDICTED: scarecrow-like protein 9-like [Gl... 67 1e-09 >ref|XP_002311175.1| GRAS family transcription factor [Populus trichocarpa] gi|222850995|gb|EEE88542.1| GRAS family transcription factor [Populus trichocarpa] Length = 740 Score = 68.9 bits (167), Expect = 4e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 397 LYHKDFVVDEDSQWMLLGWKGRIIYALSSWRP 302 LYHKDFV+DEDSQW+L GWKGRI+YALSSW+P Sbjct: 707 LYHKDFVIDEDSQWLLQGWKGRIVYALSSWKP 738 >dbj|BAC77269.2| SCARECROW-like protein [Lilium longiflorum] Length = 748 Score = 68.6 bits (166), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 400 ELYHKDFVVDEDSQWMLLGWKGRIIYALSSWRP 302 ELYHKDFVVDED +W+LLGWKGRIIYALS+W P Sbjct: 713 ELYHKDFVVDEDGRWLLLGWKGRIIYALSAWTP 745 >ref|XP_002267055.1| PREDICTED: scarecrow-like protein 9 [Vitis vinifera] Length = 743 Score = 67.8 bits (164), Expect = 9e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 394 YHKDFVVDEDSQWMLLGWKGRIIYALSSWRP 302 YHKDFV+DEDSQWML GWKGRIIYALS+W+P Sbjct: 712 YHKDFVIDEDSQWMLQGWKGRIIYALSAWKP 742 >gb|AFH54552.1| GRAS family protein, partial [Dimocarpus longan] Length = 114 Score = 67.4 bits (163), Expect = 1e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 394 YHKDFVVDEDSQWMLLGWKGRIIYALSSWRP 302 YHKDFV+DEDSQW+L GWKGRI+YALSSW+P Sbjct: 84 YHKDFVIDEDSQWLLQGWKGRIVYALSSWKP 114 >ref|XP_003522103.1| PREDICTED: scarecrow-like protein 9-like [Glycine max] Length = 728 Score = 67.0 bits (162), Expect = 1e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 394 YHKDFVVDEDSQWMLLGWKGRIIYALSSWRP 302 YHKDFV+DEDSQW+L GWKGRIIYALS WRP Sbjct: 697 YHKDFVIDEDSQWLLQGWKGRIIYALSCWRP 727