BLASTX nr result
ID: Papaver23_contig00019628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00019628 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273034.2| PREDICTED: structural maintenance of chromos... 62 4e-08 emb|CBI37123.3| unnamed protein product [Vitis vinifera] 62 4e-08 tpg|DAA48515.1| TPA: hypothetical protein ZEAMMB73_789552 [Zea m... 61 1e-07 tpg|DAA48514.1| TPA: hypothetical protein ZEAMMB73_789552 [Zea m... 61 1e-07 ref|XP_002444536.1| hypothetical protein SORBIDRAFT_07g023430 [S... 61 1e-07 >ref|XP_002273034.2| PREDICTED: structural maintenance of chromosomes protein 1A-like [Vitis vinifera] Length = 1309 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 153 LPIVDDPMETGSSMQSPVFDYSQLSRSHQQEMLPSERDKLDV 28 LP V D ME GSSM SPVFD+SQL+RSHQ +M PSER+K++V Sbjct: 1032 LPTVSDAMEIGSSMPSPVFDFSQLNRSHQVDMRPSEREKVEV 1073 >emb|CBI37123.3| unnamed protein product [Vitis vinifera] Length = 2295 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 153 LPIVDDPMETGSSMQSPVFDYSQLSRSHQQEMLPSERDKLDV 28 LP V D ME GSSM SPVFD+SQL+RSHQ +M PSER+K++V Sbjct: 2018 LPTVSDAMEIGSSMPSPVFDFSQLNRSHQVDMRPSEREKVEV 2059 >tpg|DAA48515.1| TPA: hypothetical protein ZEAMMB73_789552 [Zea mays] Length = 530 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 156 ELPIVDDPMETGSSMQSPVFDYSQLSRSHQQEMLPSERDK 37 +LP V+DPM+TG+S Q P+ DYSQLS+SH Q++ PSERDK Sbjct: 252 KLPTVNDPMDTGTSSQEPILDYSQLSKSHLQDIRPSERDK 291 >tpg|DAA48514.1| TPA: hypothetical protein ZEAMMB73_789552 [Zea mays] Length = 482 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 156 ELPIVDDPMETGSSMQSPVFDYSQLSRSHQQEMLPSERDK 37 +LP V+DPM+TG+S Q P+ DYSQLS+SH Q++ PSERDK Sbjct: 252 KLPTVNDPMDTGTSSQEPILDYSQLSKSHLQDIRPSERDK 291 >ref|XP_002444536.1| hypothetical protein SORBIDRAFT_07g023430 [Sorghum bicolor] gi|241940886|gb|EES14031.1| hypothetical protein SORBIDRAFT_07g023430 [Sorghum bicolor] Length = 1253 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 156 ELPIVDDPMETGSSMQSPVFDYSQLSRSHQQEMLPSERDK 37 +LP V+DPM+TG+S Q P+ DYSQLS+SH Q++ PSERDK Sbjct: 975 KLPTVNDPMDTGTSSQEPILDYSQLSKSHLQDIRPSERDK 1014