BLASTX nr result
ID: Papaver23_contig00018851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00018851 (623 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331863.1| outward rectifying potassium channel [Populu... 87 2e-15 ref|XP_004134597.1| PREDICTED: two-pore potassium channel 3-like... 85 9e-15 ref|XP_002519734.1| Calcium-activated outward-rectifying potassi... 83 5e-14 ref|XP_002317301.1| outward rectifying potassium channel [Populu... 80 4e-13 gb|ABX60975.1| TPK1 [Nicotiana tabacum] 74 2e-11 >ref|XP_002331863.1| outward rectifying potassium channel [Populus trichocarpa] gi|222875381|gb|EEF12512.1| outward rectifying potassium channel [Populus trichocarpa] Length = 435 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/69 (62%), Positives = 53/69 (76%) Frame = +3 Query: 417 DPPTKTNKTNLHRSKTAPAMAAINNVDHHDDHLEKPNFGTQPVIRQAVVLLFVYLSLGVV 596 DP + KTNLHRSKTAPAMA IN+++H + KP FG+Q ++RQA VLL +YLSLGV+ Sbjct: 110 DPDCQWTKTNLHRSKTAPAMAVINDLNH--PAITKPKFGSQSIVRQAFVLLVLYLSLGVL 167 Query: 597 IYSCNRDNF 623 IYS NRD F Sbjct: 168 IYSLNRDKF 176 >ref|XP_004134597.1| PREDICTED: two-pore potassium channel 3-like [Cucumis sativus] gi|449505938|ref|XP_004162609.1| PREDICTED: two-pore potassium channel 3-like [Cucumis sativus] Length = 425 Score = 85.1 bits (209), Expect = 9e-15 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +3 Query: 438 KTNLHRSKTAPAMAAINNVDHHDDHLEKPNFGTQPVIRQAVVLLFVYLSLGVVIYSCNRD 617 K+NLHRS+TAPAMA IN+V+H + KP FG Q +IRQAVVLL VYLSLGV+IY NRD Sbjct: 107 KSNLHRSRTAPAMAVINDVNHSQE--PKPQFGKQSIIRQAVVLLIVYLSLGVLIYWLNRD 164 Query: 618 NF 623 NF Sbjct: 165 NF 166 >ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 426 Score = 82.8 bits (203), Expect = 5e-14 Identities = 42/69 (60%), Positives = 49/69 (71%) Frame = +3 Query: 417 DPPTKTNKTNLHRSKTAPAMAAINNVDHHDDHLEKPNFGTQPVIRQAVVLLFVYLSLGVV 596 DP KTNLHRSKTAPAMA IN+ + H+ KP FG+Q ++RQA VLL +YLS GVV Sbjct: 100 DPNYSWTKTNLHRSKTAPAMAVIND-SLNSSHIPKPQFGSQSIVRQAFVLLILYLSFGVV 158 Query: 597 IYSCNRDNF 623 IY NR NF Sbjct: 159 IYWLNRGNF 167 >ref|XP_002317301.1| outward rectifying potassium channel [Populus trichocarpa] gi|222860366|gb|EEE97913.1| outward rectifying potassium channel [Populus trichocarpa] Length = 428 Score = 79.7 bits (195), Expect = 4e-13 Identities = 42/69 (60%), Positives = 49/69 (71%) Frame = +3 Query: 417 DPPTKTNKTNLHRSKTAPAMAAINNVDHHDDHLEKPNFGTQPVIRQAVVLLFVYLSLGVV 596 DP KTNLHRSKTAPAMA IN D + + KP FG+Q +I QA +LL +YLSLGV+ Sbjct: 103 DPNYPWTKTNLHRSKTAPAMAVIN--DFNQPVIAKPRFGSQSIIGQAFLLLVLYLSLGVL 160 Query: 597 IYSCNRDNF 623 IYS NRD F Sbjct: 161 IYSLNRDKF 169 >gb|ABX60975.1| TPK1 [Nicotiana tabacum] Length = 428 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/62 (59%), Positives = 46/62 (74%) Frame = +3 Query: 438 KTNLHRSKTAPAMAAINNVDHHDDHLEKPNFGTQPVIRQAVVLLFVYLSLGVVIYSCNRD 617 K+NLHRSKTAPAMA IN++DH D + P FG ++ Q VVLL +YL+LGV IYS RD Sbjct: 109 KSNLHRSKTAPAMATINDIDHSPDP-KPPQFGKNTIVGQGVVLLILYLTLGVGIYSLFRD 167 Query: 618 NF 623 +F Sbjct: 168 HF 169