BLASTX nr result
ID: Papaver23_contig00017214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00017214 (1026 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300559.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-09 ref|XP_002330559.1| predicted protein [Populus trichocarpa] gi|2... 65 2e-08 ref|XP_002523168.1| ATP binding protein, putative [Ricinus commu... 64 6e-08 tpg|DAA57456.1| TPA: hypothetical protein ZEAMMB73_180456 [Zea m... 60 9e-07 gb|EEC71547.1| hypothetical protein OsI_03886 [Oryza sativa Indi... 60 9e-07 >ref|XP_002300559.1| predicted protein [Populus trichocarpa] gi|222847817|gb|EEE85364.1| predicted protein [Populus trichocarpa] Length = 1716 Score = 69.7 bits (169), Expect = 1e-09 Identities = 36/65 (55%), Positives = 44/65 (67%) Frame = -2 Query: 437 RAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADSEKAEAEL 258 + EE + LEALK EA A+ KL E KYEEA KK E EK K E+KRADSE A+AE+ Sbjct: 277 KVEEYQLQLEALKKEAGLAKSKLASETLKYEEANKKFETEKLKVTKERKRADSEMAKAEV 336 Query: 257 QKRCA 243 +K+ A Sbjct: 337 KKKLA 341 Score = 68.2 bits (165), Expect = 3e-09 Identities = 37/68 (54%), Positives = 47/68 (69%) Frame = -2 Query: 446 ERNRAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADSEKAE 267 E +AEE + LE+LK EA E++ KL E K E+A KKLEAEK K E+KRADSE A+ Sbjct: 371 ELQKAEEYQLQLESLKKEAAESKSKLASETLKLEDANKKLEAEKAKVMEERKRADSEMAK 430 Query: 266 AELQKRCA 243 A+ QK+ A Sbjct: 431 AKEQKKLA 438 >ref|XP_002330559.1| predicted protein [Populus trichocarpa] gi|222872117|gb|EEF09248.1| predicted protein [Populus trichocarpa] Length = 1681 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/68 (51%), Positives = 42/68 (61%) Frame = -2 Query: 446 ERNRAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADSEKAE 267 E +AEE + LE L EA A+ KL E K+EEA KK EAEK K EKK ADSE A+ Sbjct: 266 EWKKAEEYRLQLETLTKEAELAKSKLASETLKFEEANKKFEAEKLKVTKEKKHADSEMAK 325 Query: 266 AELQKRCA 243 AE ++ A Sbjct: 326 AEAHRKLA 333 Score = 61.2 bits (147), Expect = 4e-07 Identities = 34/65 (52%), Positives = 44/65 (67%) Frame = -2 Query: 437 RAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADSEKAEAEL 258 +AEE + LE+LK EA E++ KL E K E+A K LEAEK K E+KRADSE A A+ Sbjct: 366 KAEEYQRQLESLKKEAAESKSKLVAETLKLEDANKMLEAEKAKVMKERKRADSEVATAKE 425 Query: 257 QKRCA 243 Q++ A Sbjct: 426 QRKLA 430 >ref|XP_002523168.1| ATP binding protein, putative [Ricinus communis] gi|223537575|gb|EEF39199.1| ATP binding protein, putative [Ricinus communis] Length = 1548 Score = 63.9 bits (154), Expect = 6e-08 Identities = 35/70 (50%), Positives = 43/70 (61%) Frame = -2 Query: 452 DIERNRAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADSEK 273 D E+ AE K S ++E EA+ KL E KYEEA K LEAEK K E+KRADSE Sbjct: 142 DSEKKNAEAQKKSASXXRNEVEEAKSKLVSETLKYEEASKMLEAEKNKVTEERKRADSEM 201 Query: 272 AEAELQKRCA 243 +AE Q++ A Sbjct: 202 DKAEQQRKLA 211 >tpg|DAA57456.1| TPA: hypothetical protein ZEAMMB73_180456 [Zea mays] Length = 969 Score = 60.1 bits (144), Expect = 9e-07 Identities = 33/66 (50%), Positives = 42/66 (63%) Frame = -2 Query: 458 MVDIERNRAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADS 279 + D ER A + + S E L+SEANE R +L + K EE K+ EAEK K EKKRADS Sbjct: 184 VADTERKVANDWRASCERLRSEANELRAQLTAQIQKTEEILKRAEAEKQKVAREKKRADS 243 Query: 278 EKAEAE 261 EK+ +E Sbjct: 244 EKSLSE 249 >gb|EEC71547.1| hypothetical protein OsI_03886 [Oryza sativa Indica Group] Length = 1447 Score = 60.1 bits (144), Expect = 9e-07 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = -2 Query: 452 DIERNRAEELKTSLEALKSEANEARIKLGKERSKYEEAQKKLEAEKYKANMEKKRADSEK 273 D ER A L+ S E L+SEA+EAR +L + K EEA K+ E EK KA EKK A+SEK Sbjct: 184 DTERKAANGLRASCEKLRSEASEARERLVAQVKKTEEANKRAEEEKQKAAREKKCANSEK 243 Query: 272 AEAELQK 252 + AE K Sbjct: 244 SLAEKNK 250