BLASTX nr result
ID: Papaver23_contig00015907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00015907 (1703 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY89961.1| WRKY transcription factor PmWRKY117 [Pinus montic... 58 7e-06 >gb|ABY89961.1| WRKY transcription factor PmWRKY117 [Pinus monticola] Length = 252 Score = 58.2 bits (139), Expect = 7e-06 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 6/54 (11%) Frame = +1 Query: 535 RKRERTVAFSLTPIETVEEPKVVVQAASD------DYRWHKYGQNMVKGRPNPR 678 RK+E + + P+ T++EP+VVVQ SD YRW KYGQ +VKG P+PR Sbjct: 164 RKKEENIKEMVAPLRTIKEPRVVVQTTSDVDILDDGYRWRKYGQKVVKGNPHPR 217