BLASTX nr result
ID: Papaver23_contig00015115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00015115 (545 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW86965.1| hypothetical protein ZEAMMB73_420399 [Zea mays] 57 2e-06 >gb|AFW86965.1| hypothetical protein ZEAMMB73_420399 [Zea mays] Length = 142 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 190 TRNEFSLETKSTVVAVLATRSLEVEVKVTKA*ICDTSIQERYFSMEL 330 TRNEFSLE+KST+ ATRSL+V+ KV KA I DT+ QERY S +L Sbjct: 35 TRNEFSLESKSTIGVEFATRSLQVDGKVVKAQIWDTAGQERYVSFQL 81