BLASTX nr result
ID: Papaver23_contig00014840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014840 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263312.1| PREDICTED: uncharacterized protein LOC100261... 47 3e-08 >ref|XP_002263312.1| PREDICTED: uncharacterized protein LOC100261746 [Vitis vinifera] Length = 751 Score = 46.6 bits (109), Expect(2) = 3e-08 Identities = 32/85 (37%), Positives = 45/85 (52%), Gaps = 5/85 (5%) Frame = -1 Query: 436 EGDRGGKKRKSKWTDNGSLL*KVCPISLKYLFQLLILKS-----QELDERLLGINTKLCG 272 EG+R K+RK++WT + S L + PI L + + QEL L IN+KL Sbjct: 196 EGNRTRKRRKTRWTGDDSQLKILGPIQLPSFVKDFVTSDLDPEIQELKVELFEINSKLQR 255 Query: 271 EGIHDDRTEEEWSLCSPPLLYDNFG 197 +HDDR +E+ S SP +YD G Sbjct: 256 PELHDDRPKEDRS-PSPEPVYDYLG 279 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = -2 Query: 213 CMITLVTFRSCTPEP----KPALFFKKLYLPIREYPGYNF 106 C+I+ + ++ T +P KP KKLY+P +EYP YNF Sbjct: 299 CIISRLIEKNSTFKPAADYKPPKLIKKLYIPEKEYPDYNF 338