BLASTX nr result
ID: Papaver23_contig00014619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00014619 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF75824.1| CDK activating kinase [Nicotiana tabacum] 56 3e-06 >dbj|BAF75824.1| CDK activating kinase [Nicotiana tabacum] Length = 411 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 495 SETIPMSVDFSAFGSRPPPRPTLNSADRSHL 403 SE +PMS+DFS FG RPP RPT+NSADRSHL Sbjct: 368 SEQVPMSLDFSVFGMRPPTRPTINSADRSHL 398