BLASTX nr result
ID: Papaver23_contig00012859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00012859 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306708.1| predicted protein [Populus trichocarpa] gi|1... 67 2e-09 ref|XP_002263053.2| PREDICTED: 60S ribosomal protein L3 [Vitis v... 66 3e-09 gb|ADR71240.1| 60S ribosomal protein L3B [Hevea brasiliensis] 65 6e-09 gb|ADR71239.1| 60S ribosomal protein L3A [Hevea brasiliensis] 65 6e-09 ref|XP_003592084.1| L3 Ribosomal protein [Medicago truncatula] g... 65 8e-09 >ref|XP_002306708.1| predicted protein [Populus trichocarpa] gi|118481111|gb|ABK92509.1| unknown [Populus trichocarpa] gi|222856157|gb|EEE93704.1| predicted protein [Populus trichocarpa] Length = 389 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +2 Query: 119 KVKDFPKDDPTNPYKLTDFLGYKACMTHIV*EVEKSGSN*DVQATC 256 KVK FPKDDPT P KLT FLGYKA MTHIV EVEK GS + TC Sbjct: 28 KVKSFPKDDPTKPCKLTSFLGYKAGMTHIVREVEKPGSKLHKKETC 73 >ref|XP_002263053.2| PREDICTED: 60S ribosomal protein L3 [Vitis vinifera] gi|297739519|emb|CBI29701.3| unnamed protein product [Vitis vinifera] Length = 389 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +2 Query: 119 KVKDFPKDDPTNPYKLTDFLGYKACMTHIV*EVEKSGSN*DVQATC 256 KVK FPKDDPTNP +LT FLGYKA MTHIV EVEK GS + TC Sbjct: 28 KVKAFPKDDPTNPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKETC 73 >gb|ADR71240.1| 60S ribosomal protein L3B [Hevea brasiliensis] Length = 389 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +2 Query: 119 KVKDFPKDDPTNPYKLTDFLGYKACMTHIV*EVEKSGSN*DVQATC 256 KVK FPKDDPT P KLT FLGYKA MTHIV EVEK GS + TC Sbjct: 28 KVKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKETC 73 >gb|ADR71239.1| 60S ribosomal protein L3A [Hevea brasiliensis] Length = 389 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +2 Query: 119 KVKDFPKDDPTNPYKLTDFLGYKACMTHIV*EVEKSGSN*DVQATC 256 KVK FPKDDPT P KLT FLGYKA MTHIV EVEK GS + TC Sbjct: 28 KVKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGSKLHKKETC 73 >ref|XP_003592084.1| L3 Ribosomal protein [Medicago truncatula] gi|355481132|gb|AES62335.1| L3 Ribosomal protein [Medicago truncatula] Length = 455 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +2 Query: 119 KVKDFPKDDPTNPYKLTDFLGYKACMTHIV*EVEKSGSN*DVQATC 256 KVK FPKDDPT P KLT FLGYKA MTHIV EVEK GS + TC Sbjct: 94 KVKAFPKDDPTKPPKLTAFLGYKAGMTHIVREVEKPGSKLHKKETC 139