BLASTX nr result
ID: Papaver23_contig00007995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00007995 (633 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606827.1| Ribosome biogenesis protein BMS1-like protei... 58 2e-06 ref|XP_003606826.1| Ribosome biogenesis protein BMS1-like protei... 58 2e-06 ref|XP_003606825.1| Ribosome biogenesis protein BMS1-like protei... 58 2e-06 ref|XP_004161775.1| PREDICTED: ribosome biogenesis protein BMS1 ... 57 3e-06 ref|XP_004139860.1| PREDICTED: ribosome biogenesis protein BMS1 ... 57 3e-06 >ref|XP_003606827.1| Ribosome biogenesis protein BMS1-like protein [Medicago truncatula] gi|355507882|gb|AES89024.1| Ribosome biogenesis protein BMS1-like protein [Medicago truncatula] Length = 988 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 43 RLLKFTPEHNHCLAMFWGPLAPPLTRIAVVQS 138 R+LK+TPEH HCLAMFWGPLAPP T I VQ+ Sbjct: 858 RMLKYTPEHMHCLAMFWGPLAPPNTGIVAVQT 889 >ref|XP_003606826.1| Ribosome biogenesis protein BMS1-like protein [Medicago truncatula] gi|355507881|gb|AES89023.1| Ribosome biogenesis protein BMS1-like protein [Medicago truncatula] Length = 1175 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 43 RLLKFTPEHNHCLAMFWGPLAPPLTRIAVVQS 138 R+LK+TPEH HCLAMFWGPLAPP T I VQ+ Sbjct: 858 RMLKYTPEHMHCLAMFWGPLAPPNTGIVAVQT 889 >ref|XP_003606825.1| Ribosome biogenesis protein BMS1-like protein [Medicago truncatula] gi|355507880|gb|AES89022.1| Ribosome biogenesis protein BMS1-like protein [Medicago truncatula] Length = 1200 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 43 RLLKFTPEHNHCLAMFWGPLAPPLTRIAVVQS 138 R+LK+TPEH HCLAMFWGPLAPP T I VQ+ Sbjct: 858 RMLKYTPEHMHCLAMFWGPLAPPNTGIVAVQT 889 >ref|XP_004161775.1| PREDICTED: ribosome biogenesis protein BMS1 homolog [Cucumis sativus] Length = 553 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 43 RLLKFTPEHNHCLAMFWGPLAPPLTRIAVVQS 138 R+LK+TPEH HCLAMFWGPLAPP T + VQ+ Sbjct: 236 RMLKYTPEHMHCLAMFWGPLAPPNTGVIAVQT 267 >ref|XP_004139860.1| PREDICTED: ribosome biogenesis protein BMS1 homolog [Cucumis sativus] Length = 1198 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 43 RLLKFTPEHNHCLAMFWGPLAPPLTRIAVVQS 138 R+LK+TPEH HCLAMFWGPLAPP T + VQ+ Sbjct: 881 RMLKYTPEHMHCLAMFWGPLAPPNTGVIAVQT 912