BLASTX nr result
ID: Papaver23_contig00007792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00007792 (513 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H85073 probable transposon protein [imported] - Arabidopsis... 64 1e-08 gb|AAD48963.1|AF147263_5 contains similarity to transposases [Ar... 58 7e-07 gb|AAF79835.1|AC026875_15 T6D22.19 [Arabidopsis thaliana] 56 3e-06 gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thali... 55 5e-06 gb|AAD17360.1| contains similarity to transposase [Arabidopsis t... 55 5e-06 >pir||H85073 probable transposon protein [imported] - Arabidopsis thaliana gi|5032279|gb|AAD38227.1|AF147264_10 may be a pseudogene [Arabidopsis thaliana] gi|7267351|emb|CAB81124.1| putative transposon protein [Arabidopsis thaliana] Length = 483 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/75 (41%), Positives = 47/75 (62%) Frame = -2 Query: 227 RARKIDHTKFREFISKLIIARNLPLSLVEWPKFRDLCAYLNDDVNTLSRNTSKVDILKSH 48 +ARKID + FRE ++K II +LP S VE+ + R+ YLN DV SRNT+ DI K + Sbjct: 9 QARKIDQSVFRELVAKTIIQHDLPFSYVEYERVRETWKYLNADVKFFSRNTAAADIYKFY 68 Query: 47 GMRKEAIRKRLKCVP 3 + + +++ L +P Sbjct: 69 EIETDKLKRELAQLP 83 >gb|AAD48963.1|AF147263_5 contains similarity to transposases [Arabidopsis thaliana] gi|7267311|emb|CAB81093.1| AT4g05510 [Arabidopsis thaliana] Length = 604 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/75 (34%), Positives = 44/75 (58%) Frame = -2 Query: 227 RARKIDHTKFREFISKLIIARNLPLSLVEWPKFRDLCAYLNDDVNTLSRNTSKVDILKSH 48 + KIDH RE S++II +LP VE+ + RD +Y+N D +RNT+ D++K+ Sbjct: 91 KTTKIDHKVVREKFSRVIIRHDLPFLCVEYEELRDFISYMNPDYKCYTRNTAAADVVKTW 150 Query: 47 GMRKEAIRKRLKCVP 3 K+ ++ L+ +P Sbjct: 151 EKEKQILKSELERIP 165 >gb|AAF79835.1|AC026875_15 T6D22.19 [Arabidopsis thaliana] Length = 745 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/74 (33%), Positives = 43/74 (58%) Frame = -2 Query: 224 ARKIDHTKFREFISKLIIARNLPLSLVEWPKFRDLCAYLNDDVNTLSRNTSKVDILKSHG 45 +RK+D FRE I+ ++ NLP S VE+ + R+ Y+N + SRNT+ D+ K + Sbjct: 202 SRKVDMMVFREMIAVALVQHNLPYSFVEYERIREAFTYVNPSIEFWSRNTAASDVYKIYE 261 Query: 44 MRKEAIRKRLKCVP 3 K ++++L +P Sbjct: 262 REKIKLKEKLAIIP 275 >gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thaliana] Length = 577 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/74 (33%), Positives = 42/74 (56%) Frame = -2 Query: 224 ARKIDHTKFREFISKLIIARNLPLSLVEWPKFRDLCAYLNDDVNTLSRNTSKVDILKSHG 45 +RK+D FRE I+ ++ NLP S VE+ + R+ Y N + SRNT+ D+ K + Sbjct: 19 SRKVDMMVFREMIAVALVQHNLPYSFVEYERIREAFTYANPSIEFWSRNTAAFDVYKIYE 78 Query: 44 MRKEAIRKRLKCVP 3 K ++++L +P Sbjct: 79 REKIKLKEKLAIIP 92 >gb|AAD17360.1| contains similarity to transposase [Arabidopsis thaliana] Length = 428 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/75 (38%), Positives = 45/75 (60%) Frame = -2 Query: 227 RARKIDHTKFREFISKLIIARNLPLSLVEWPKFRDLCAYLNDDVNTLSRNTSKVDILKSH 48 +ARKIDH FRE ++K II +L + VE+ K R + YLN V ++RNT+ D+LK + Sbjct: 179 QARKIDHIVFREKVAKCIIQHDLLFAYVEYEKVRSVWKYLNAYVKFITRNTTVADVLKLY 238 Query: 47 GMRKEAIRKRLKCVP 3 +++ L +P Sbjct: 239 ENETGNLKRELAQLP 253