BLASTX nr result
ID: Papaver23_contig00006801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00006801 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003558232.1| PREDICTED: palmitoyltransferase ZDHHC17-like... 73 3e-11 tpg|DAA44658.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 70 2e-10 tpg|DAA44657.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 70 2e-10 tpg|DAA44654.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 70 2e-10 ref|NP_001148505.1| DHHC zinc finger domain containing protein [... 70 2e-10 >ref|XP_003558232.1| PREDICTED: palmitoyltransferase ZDHHC17-like [Brachypodium distachyon] Length = 313 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = -2 Query: 461 NIKTDEWINWRKYPEFQLFHPQAGQAYPEIGFINPYDKGVLANIKEILSPR 309 NIKTDEWINW+KYPEFQ+ + Q+ EI F+NPYDKG+L NI+E L P+ Sbjct: 265 NIKTDEWINWKKYPEFQM--KEEPQSDSEIKFVNPYDKGMLCNIREFLKPK 313 >tpg|DAA44658.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 58 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -2 Query: 461 NIKTDEWINWRKYPEFQLFHPQAGQAYPEIGFINPYDKGVLANIKEILSP 312 NIKTDEWINW+KYPEFQ+ + ++ E+ F+NPYDKG+L NI+E L P Sbjct: 10 NIKTDEWINWKKYPEFQM--KEQPRSDSEVKFVNPYDKGMLCNIREFLKP 57 >tpg|DAA44657.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 331 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -2 Query: 461 NIKTDEWINWRKYPEFQLFHPQAGQAYPEIGFINPYDKGVLANIKEILSP 312 NIKTDEWINW+KYPEFQ+ + ++ E+ F+NPYDKG+L NI+E L P Sbjct: 283 NIKTDEWINWKKYPEFQM--KEQPRSDSEVKFVNPYDKGMLCNIREFLKP 330 >tpg|DAA44654.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 300 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -2 Query: 461 NIKTDEWINWRKYPEFQLFHPQAGQAYPEIGFINPYDKGVLANIKEILSP 312 NIKTDEWINW+KYPEFQ+ + ++ E+ F+NPYDKG+L NI+E L P Sbjct: 252 NIKTDEWINWKKYPEFQM--KEQPRSDSEVKFVNPYDKGMLCNIREFLKP 299 >ref|NP_001148505.1| DHHC zinc finger domain containing protein [Zea mays] gi|223945801|gb|ACN26984.1| unknown [Zea mays] gi|414866098|tpg|DAA44655.1| TPA: DHHC zinc finger domain containing protein [Zea mays] Length = 315 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -2 Query: 461 NIKTDEWINWRKYPEFQLFHPQAGQAYPEIGFINPYDKGVLANIKEILSP 312 NIKTDEWINW+KYPEFQ+ + ++ E+ F+NPYDKG+L NI+E L P Sbjct: 267 NIKTDEWINWKKYPEFQM--KEQPRSDSEVKFVNPYDKGMLCNIREFLKP 314