BLASTX nr result
ID: Papaver23_contig00006170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00006170 (2721 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145972.1| PREDICTED: SKP1-like protein 21-like [Cucumi... 84 2e-13 emb|CBI22695.3| unnamed protein product [Vitis vinifera] 84 2e-13 ref|XP_002269721.1| PREDICTED: SKP1-like protein 21-like [Vitis ... 84 2e-13 ref|XP_002513681.1| ubiquitin-protein ligase, putative [Ricinus ... 84 2e-13 emb|CAN61206.1| hypothetical protein VITISV_015445 [Vitis vinifera] 84 2e-13 >ref|XP_004145972.1| PREDICTED: SKP1-like protein 21-like [Cucumis sativus] gi|449524038|ref|XP_004169030.1| PREDICTED: SKP1-like protein 21-like [Cucumis sativus] Length = 425 Score = 84.0 bits (206), Expect = 2e-13 Identities = 46/74 (62%), Positives = 53/74 (71%), Gaps = 3/74 (4%) Frame = +2 Query: 1226 MKSYIWLQTSGGSIQQVE*EVCSFSPMICREVL*ISMGSTKNCAILLSQQEN---IT*LL 1396 MKSYIWLQT+ GSIQQVE EV F PMICRE+L MGS+KN AI L Q+ N + +L Sbjct: 13 MKSYIWLQTADGSIQQVEEEVAMFCPMICREILQTGMGSSKNYAISLPQRVNPAILGLIL 72 Query: 1397 PIWRFYQVPSRSNK 1438 RF+QVP RSNK Sbjct: 73 DYCRFHQVPGRSNK 86 >emb|CBI22695.3| unnamed protein product [Vitis vinifera] Length = 358 Score = 84.0 bits (206), Expect = 2e-13 Identities = 46/74 (62%), Positives = 53/74 (71%), Gaps = 3/74 (4%) Frame = +2 Query: 1226 MKSYIWLQTSGGSIQQVE*EVCSFSPMICREVL*ISMGSTKNCAILLSQQEN---IT*LL 1396 MKSYIWLQT+ GSIQQVE EV F PMICRE+L MGS+KN AI L Q+ N + +L Sbjct: 13 MKSYIWLQTADGSIQQVEEEVAMFCPMICREILQTGMGSSKNYAISLPQRVNPAILGLIL 72 Query: 1397 PIWRFYQVPSRSNK 1438 RF+QVP RSNK Sbjct: 73 DYCRFHQVPGRSNK 86 >ref|XP_002269721.1| PREDICTED: SKP1-like protein 21-like [Vitis vinifera] Length = 359 Score = 84.0 bits (206), Expect = 2e-13 Identities = 46/74 (62%), Positives = 53/74 (71%), Gaps = 3/74 (4%) Frame = +2 Query: 1226 MKSYIWLQTSGGSIQQVE*EVCSFSPMICREVL*ISMGSTKNCAILLSQQEN---IT*LL 1396 MKSYIWLQT+ GSIQQVE EV F PMICRE+L MGS+KN AI L Q+ N + +L Sbjct: 13 MKSYIWLQTADGSIQQVEEEVAMFCPMICREILQTGMGSSKNYAISLPQRVNPAILGLIL 72 Query: 1397 PIWRFYQVPSRSNK 1438 RF+QVP RSNK Sbjct: 73 DYCRFHQVPGRSNK 86 >ref|XP_002513681.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547589|gb|EEF49084.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 378 Score = 84.0 bits (206), Expect = 2e-13 Identities = 46/74 (62%), Positives = 53/74 (71%), Gaps = 3/74 (4%) Frame = +2 Query: 1226 MKSYIWLQTSGGSIQQVE*EVCSFSPMICREVL*ISMGSTKNCAILLSQQEN---IT*LL 1396 MKSYIWLQT+ GSIQQVE EV F PMICRE+L MGS+KN AI L Q+ N + +L Sbjct: 1 MKSYIWLQTADGSIQQVEEEVAMFCPMICREILQTGMGSSKNYAISLPQRVNPAILGLIL 60 Query: 1397 PIWRFYQVPSRSNK 1438 RF+QVP RSNK Sbjct: 61 DYCRFHQVPGRSNK 74 >emb|CAN61206.1| hypothetical protein VITISV_015445 [Vitis vinifera] Length = 273 Score = 84.0 bits (206), Expect = 2e-13 Identities = 46/74 (62%), Positives = 53/74 (71%), Gaps = 3/74 (4%) Frame = +2 Query: 1226 MKSYIWLQTSGGSIQQVE*EVCSFSPMICREVL*ISMGSTKNCAILLSQQEN---IT*LL 1396 MKSYIWLQT+ GSIQQVE EV F PMICRE+L MGS+KN AI L Q+ N + +L Sbjct: 1 MKSYIWLQTADGSIQQVEEEVAMFCPMICREILQTGMGSSKNYAISLPQRVNPAILGLIL 60 Query: 1397 PIWRFYQVPSRSNK 1438 RF+QVP RSNK Sbjct: 61 DYCRFHQVPGRSNK 74