BLASTX nr result
ID: Papaver23_contig00004104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00004104 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516994.1| PREDICTED: uncharacterized protein LOC100809... 72 5e-11 gb|ACU18943.1| unknown [Glycine max] 72 5e-11 ref|XP_002303431.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002528545.1| nucleic acid binding protein, putative [Rici... 71 1e-10 ref|XP_002281499.2| PREDICTED: protein vip1-like [Vitis vinifera... 70 1e-10 >ref|XP_003516994.1| PREDICTED: uncharacterized protein LOC100809613 [Glycine max] Length = 279 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 279 EVSNISLRATEQDIKEFFSFSGDIEYVEMKREDEPCQVAYVTFK 410 +VSN+SL ATEQDIKEFFSFSGDIEYVE++ DE Q+AY+TFK Sbjct: 7 KVSNVSLGATEQDIKEFFSFSGDIEYVELRSHDERSQIAYITFK 50 >gb|ACU18943.1| unknown [Glycine max] Length = 279 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 279 EVSNISLRATEQDIKEFFSFSGDIEYVEMKREDEPCQVAYVTFK 410 +VSN+SL ATEQDIKEFFSFSGDIEYVE++ DE Q+AY+TFK Sbjct: 7 KVSNVSLGATEQDIKEFFSFSGDIEYVELRSHDERSQIAYITFK 50 >ref|XP_002303431.1| predicted protein [Populus trichocarpa] gi|222840863|gb|EEE78410.1| predicted protein [Populus trichocarpa] Length = 276 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +3 Query: 279 EVSNISLRATEQDIKEFFSFSGDIEYVEMKREDEPCQVAYVTFK 410 +VSN+SL A+EQD+KEFFSFSGDIEYVEMK E+E Q+AYV+FK Sbjct: 11 KVSNVSLGASEQDLKEFFSFSGDIEYVEMKSENEQSQIAYVSFK 54 >ref|XP_002528545.1| nucleic acid binding protein, putative [Ricinus communis] gi|223532047|gb|EEF33857.1| nucleic acid binding protein, putative [Ricinus communis] Length = 275 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = +3 Query: 279 EVSNISLRATEQDIKEFFSFSGDIEYVEMKREDEPCQVAYVTFK 410 +VSN+SL ATE+D++EFFSFSGDIEYVE++R+DE Q+AYVT+K Sbjct: 7 KVSNVSLGATERDLREFFSFSGDIEYVEVRRDDEKSQIAYVTYK 50 >ref|XP_002281499.2| PREDICTED: protein vip1-like [Vitis vinifera] gi|297737602|emb|CBI26803.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 279 EVSNISLRATEQDIKEFFSFSGDIEYVEMKREDEPCQVAYVTFK 410 +VSNISL TE+DIKEFFSFSGDI+YVEM+RE E Q+AYVTFK Sbjct: 35 KVSNISLAVTERDIKEFFSFSGDIQYVEMQREAEKTQLAYVTFK 78