BLASTX nr result
ID: Papaver23_contig00002931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00002931 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533502.1| conserved hypothetical protein [Ricinus comm... 99 4e-19 ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|2... 98 8e-19 ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250... 96 4e-18 emb|CAN71484.1| hypothetical protein VITISV_025338 [Vitis vinifera] 94 1e-17 >ref|XP_002533502.1| conserved hypothetical protein [Ricinus communis] gi|223526646|gb|EEF28889.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/99 (48%), Positives = 63/99 (63%), Gaps = 3/99 (3%) Frame = -3 Query: 412 ARPTSQYEKLVQILPRVYIGRSEELKQITKLMSEAAKKSLKVNQLLLSPWRKNRFMQMRW 233 ARPT++Y K VQ LPRV++G+SE LK+I K+MS+AAK+SLK L L PWRKNR+MQ +W Sbjct: 180 ARPTNEYRKQVQSLPRVFVGKSENLKRIIKVMSDAAKRSLKTRDLSLPPWRKNRYMQNKW 239 Query: 232 FGPYKRTLNQVXXXXXXXXXXXTMAIQ---LGFHQKINS 125 GPY RT N ++ GF + +NS Sbjct: 240 LGPYHRTCNHQLSANPTMIEASVSVVKCRLFGFEEAVNS 278 >ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|222850077|gb|EEE87624.1| predicted protein [Populus trichocarpa] Length = 289 Score = 98.2 bits (243), Expect = 6e-19 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = -3 Query: 412 ARPTSQYEKLVQILPRVYIGRSEELKQITKLMSEAAKKSLKVNQLLLSPWRKNRFMQMRW 233 ARPTSQ+ KL LPRV++GRSE+LK I K +S+A+K+SLK +L L PWRKNR+MQ +W Sbjct: 189 ARPTSQFLKLQHSLPRVFVGRSEDLKTIVKSISDASKRSLKSRELSLPPWRKNRYMQNKW 248 Query: 232 FGPYKRTLN 206 FGPY+RT+N Sbjct: 249 FGPYRRTVN 257 >ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|222848523|gb|EEE86070.1| predicted protein [Populus trichocarpa] Length = 289 Score = 97.8 bits (242), Expect = 8e-19 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = -3 Query: 412 ARPTSQYEKLVQILPRVYIGRSEELKQITKLMSEAAKKSLKVNQLLLSPWRKNRFMQMRW 233 ARPTSQY KL+ LPRV++G+SE+LK I + +S+AAK+SLK +L L PWRKNR+MQ +W Sbjct: 186 ARPTSQYLKLLHHLPRVFVGKSEDLKTIVRSISDAAKRSLKSRELSLPPWRKNRYMQNKW 245 Query: 232 FGPYKRTLN 206 FGPY RT+N Sbjct: 246 FGPYLRTVN 254 >ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250319 [Vitis vinifera] gi|296090565|emb|CBI40915.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 95.5 bits (236), Expect = 4e-18 Identities = 43/67 (64%), Positives = 55/67 (82%) Frame = -3 Query: 412 ARPTSQYEKLVQILPRVYIGRSEELKQITKLMSEAAKKSLKVNQLLLSPWRKNRFMQMRW 233 ARPT QY++L+Q LPRV+IG+SE+LK+I KL +AAK+SLK L L PWRKNR+MQ +W Sbjct: 180 ARPTDQYKRLIQTLPRVFIGKSEDLKKIVKLTCDAAKRSLKSRGLHLPPWRKNRYMQNKW 239 Query: 232 FGPYKRT 212 FGP +RT Sbjct: 240 FGPCRRT 246 >emb|CAN71484.1| hypothetical protein VITISV_025338 [Vitis vinifera] Length = 282 Score = 93.6 bits (231), Expect = 1e-17 Identities = 42/66 (63%), Positives = 54/66 (81%) Frame = -3 Query: 412 ARPTSQYEKLVQILPRVYIGRSEELKQITKLMSEAAKKSLKVNQLLLSPWRKNRFMQMRW 233 ARPT QY++L+Q LPRV+IG+SE+LK+I KL +AAK+SLK L L PWRKNR+MQ +W Sbjct: 180 ARPTDQYKRLIQTLPRVFIGKSEDLKKIVKLTCDAAKRSLKSRGLHLPPWRKNRYMQNKW 239 Query: 232 FGPYKR 215 FGP +R Sbjct: 240 FGPCRR 245