BLASTX nr result
ID: Papaver23_contig00001386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00001386 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462404.1| hypothetical protein SORBIDRAFT_02g025120 [S... 46 3e-09 gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prun... 43 8e-09 gb|ACV52080.1| small uORF [Sorghum bicolor] gi|257220655|gb|ACV5... 44 2e-08 gb|AAC48988.1| putative [Catharanthus roseus] 44 3e-08 gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] 44 4e-08 >ref|XP_002462404.1| hypothetical protein SORBIDRAFT_02g025120 [Sorghum bicolor] gi|241925781|gb|EER98925.1| hypothetical protein SORBIDRAFT_02g025120 [Sorghum bicolor] gi|257220646|gb|ACV52077.1| small uORF [Sorghum bicolor] gi|257220659|gb|ACV52087.1| small uORF [Sorghum bicolor] Length = 49 Score = 45.8 bits (107), Expect(2) = 3e-09 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 328 IRPAGGIKKFKSAAYCNCSRKPS 396 +RPAGGIKKF+SAAY NC+RKPS Sbjct: 27 VRPAGGIKKFQSAAYSNCARKPS 49 Score = 40.4 bits (93), Expect(2) = 3e-09 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +3 Query: 144 MEAKGGEDSSSDSLVYEAPFGYSIED 221 ME+KGG+ SSS + +YEAP GY IED Sbjct: 1 MESKGGKKSSSSNFMYEAPLGYKIED 26 >gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prunus dulcis] Length = 56 Score = 42.7 bits (99), Expect(2) = 8e-09 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +1 Query: 328 IRPAGGIKKFKSAAYCNCSRKPS 396 +RP GGIKKF+SAAY NC RKPS Sbjct: 34 VRPHGGIKKFRSAAYSNCVRKPS 56 Score = 42.0 bits (97), Expect(2) = 8e-09 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +3 Query: 132 ITQLMEAKGGE--DSSSDSLVYEAPFGYSIED 221 + +LME+KGG+ SSS SL YEAP GYSIED Sbjct: 2 LNELMESKGGKKKSSSSKSLFYEAPLGYSIED 33 >gb|ACV52080.1| small uORF [Sorghum bicolor] gi|257220655|gb|ACV52084.1| small uORF [Sorghum bicolor] Length = 50 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 17/23 (73%), Positives = 22/23 (95%) Frame = +1 Query: 328 IRPAGGIKKFKSAAYCNCSRKPS 396 +RPAGG+KKF+SAAY NC++KPS Sbjct: 28 VRPAGGVKKFQSAAYSNCAKKPS 50 Score = 39.3 bits (90), Expect(2) = 2e-08 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = +3 Query: 144 MEAKGGEDSSSD-SLVYEAPFGYSIED 221 ME+KGG+ SSS S++YEAP GYSIED Sbjct: 1 MESKGGKKSSSSRSMMYEAPLGYSIED 27 >gb|AAC48988.1| putative [Catharanthus roseus] Length = 51 Score = 43.9 bits (102), Expect(2) = 3e-08 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = +1 Query: 328 IRPAGGIKKFKSAAYCNCSRKPS 396 +RP GGIKKF+SAAY NC+RKPS Sbjct: 29 VRPNGGIKKFRSAAYSNCARKPS 51 Score = 38.9 bits (89), Expect(2) = 3e-08 Identities = 20/28 (71%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = +3 Query: 144 MEAKGGE--DSSSDSLVYEAPFGYSIED 221 ME+KGG+ SSS SL YEAP GYSIED Sbjct: 1 MESKGGKKKSSSSKSLFYEAPLGYSIED 28 >gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] Length = 53 Score = 44.3 bits (103), Expect(2) = 4e-08 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +1 Query: 328 IRPAGGIKKFKSAAYCNCSRKPS 396 IRP GGIKKF+SAAY NC+RKPS Sbjct: 31 IRPNGGIKKFRSAAYSNCARKPS 53 Score = 38.1 bits (87), Expect(2) = 4e-08 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 4/30 (13%) Frame = +3 Query: 144 MEAKGGE----DSSSDSLVYEAPFGYSIED 221 ME+KGG+ SSS SL YEAP GYSIED Sbjct: 1 MESKGGKKKSSSSSSKSLFYEAPLGYSIED 30