BLASTX nr result
ID: Papaver23_contig00001281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00001281 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307602.1| homocysteine s-methyltransferase [Populus tr... 61 1e-07 ref|XP_002314674.1| homocysteine s-methyltransferase [Populus tr... 60 1e-07 ref|XP_002517092.1| 5-methyltetrahydrofolate:homocysteine methyl... 60 2e-07 gb|AGF95112.1| homocysteine S-methyltransferase, partial [Prunus... 57 1e-06 ref|XP_002885522.1| homocysteine S-methyltransferase 3 [Arabidop... 57 2e-06 >ref|XP_002307602.1| homocysteine s-methyltransferase [Populus trichocarpa] gi|222857051|gb|EEE94598.1| homocysteine s-methyltransferase [Populus trichocarpa] Length = 341 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +1 Query: 1 VNKWHEAGAALIGGCCRTTPNTIRAIANNLSKGSDAP 111 VNKW E GAAL+GGCCRTTPNTIRAI LS S AP Sbjct: 303 VNKWCEIGAALVGGCCRTTPNTIRAIYRTLSSRSPAP 339 >ref|XP_002314674.1| homocysteine s-methyltransferase [Populus trichocarpa] gi|222863714|gb|EEF00845.1| homocysteine s-methyltransferase [Populus trichocarpa] Length = 338 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 VNKWHEAGAALIGGCCRTTPNTIRAIANNLSK 96 +NKW EAGA+L GGCCRTTPNTIRAI N LSK Sbjct: 305 INKWREAGASLFGGCCRTTPNTIRAIGNVLSK 336 >ref|XP_002517092.1| 5-methyltetrahydrofolate:homocysteine methyltransferase, putative [Ricinus communis] gi|223543727|gb|EEF45255.1| 5-methyltetrahydrofolate:homocysteine methyltransferase, putative [Ricinus communis] Length = 348 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 1 VNKWHEAGAALIGGCCRTTPNTIRAIANNLSKGSDAP 111 + KW EAGA+L GGCCRTTPNTIRAI N+S S P Sbjct: 304 IGKWREAGASLFGGCCRTTPNTIRAICRNISNKSSPP 340 >gb|AGF95112.1| homocysteine S-methyltransferase, partial [Prunus persica] Length = 368 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 VNKWHEAGAALIGGCCRTTPNTIRAIANNLS 93 + KWHEAGA+L GGCCRTTPNTIRAI+ LS Sbjct: 327 IGKWHEAGASLFGGCCRTTPNTIRAISRVLS 357 >ref|XP_002885522.1| homocysteine S-methyltransferase 3 [Arabidopsis lyrata subsp. lyrata] gi|297331362|gb|EFH61781.1| homocysteine S-methyltransferase 3 [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 VNKWHEAGAALIGGCCRTTPNTIRAIANNLSKGSDA 108 V+KW +AGA+L GGCCRTTPNTIRAIA LS S A Sbjct: 304 VSKWRDAGASLFGGCCRTTPNTIRAIAKVLSDESPA 339