BLASTX nr result
ID: Papaver23_contig00001053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00001053 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510538.1| conserved hypothetical protein [Ricinus comm... 72 4e-11 ref|XP_002306929.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 gb|ABK92449.1| unknown [Populus trichocarpa] 70 2e-10 ref|XP_002275494.2| PREDICTED: uncharacterized protein LOC100242... 67 2e-09 ref|XP_004162563.1| PREDICTED: uncharacterized LOC101214860 [Cuc... 65 7e-09 >ref|XP_002510538.1| conserved hypothetical protein [Ricinus communis] gi|223551239|gb|EEF52725.1| conserved hypothetical protein [Ricinus communis] Length = 273 Score = 72.4 bits (176), Expect = 4e-11 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = -3 Query: 455 ERDPLRIFYETLYKQLPNSEMAAFWMLESGLLPREEAA---XXXXXXXXXXVLNSPIKAI 285 ERDPLRIFYETLYKQLPNSEMA WM+ESGLL +EEA L+SP+KAI Sbjct: 146 ERDPLRIFYETLYKQLPNSEMAQIWMMESGLLSKEEAKKVYEKKQKKKNQQKLSSPVKAI 205 >ref|XP_002306929.1| predicted protein [Populus trichocarpa] gi|222856378|gb|EEE93925.1| predicted protein [Populus trichocarpa] Length = 299 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -3 Query: 455 ERDPLRIFYETLYKQLPNSEMAAFWMLESGLLPREEAAXXXXXXXXXXVLNSPIKAI 285 ERDPLRIFYETLY+Q+P SEMA FW++ESGLLP E A SP+K I Sbjct: 162 ERDPLRIFYETLYEQIPESEMAQFWLMESGLLPLEMAKKVHEKKQKKNKFTSPVKTI 218 >gb|ABK92449.1| unknown [Populus trichocarpa] Length = 301 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -3 Query: 455 ERDPLRIFYETLYKQLPNSEMAAFWMLESGLLPREEAAXXXXXXXXXXVLNSPIKAI 285 ERDPLRIFYETLY+Q+P SEMA FW++ESGLLP E A SP+K I Sbjct: 164 ERDPLRIFYETLYEQIPESEMAQFWLMESGLLPLEMAKKVHVKKQKKNKFTSPVKTI 220 >ref|XP_002275494.2| PREDICTED: uncharacterized protein LOC100242110 [Vitis vinifera] gi|302142663|emb|CBI19866.3| unnamed protein product [Vitis vinifera] Length = 223 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -3 Query: 455 ERDPLRIFYETLYKQLPNSEMAAFWMLESGLLPREEA 345 ERDPLRIFYETL++Q+P SEMAAFWM+ESGLLP++ A Sbjct: 108 ERDPLRIFYETLFEQVPGSEMAAFWMMESGLLPKDVA 144 >ref|XP_004162563.1| PREDICTED: uncharacterized LOC101214860 [Cucumis sativus] Length = 294 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 455 ERDPLRIFYETLYKQLPNSEMAAFWMLESGLLPREEA 345 ERDPLRIFYE+L+KQLP+SEMA FWM+E GLL +EEA Sbjct: 148 ERDPLRIFYESLHKQLPHSEMAQFWMMEYGLLSKEEA 184