BLASTX nr result
ID: Papaver22_contig00035667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00035667 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525041.1| hypothetical protein RCOM_0882000 [Ricinus c... 57 2e-06 >ref|XP_002525041.1| hypothetical protein RCOM_0882000 [Ricinus communis] gi|223535703|gb|EEF37368.1| hypothetical protein RCOM_0882000 [Ricinus communis] Length = 147 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -1 Query: 420 IQWVYQLFNSTATGWNEDLLQKLFEPIQVAAILSIPID-SQHPDSLVWPLTSSGRFTTKS 244 I WV+QL +S + W EDL++ LF P + A IL +P+ +Q D LVW TSSG + +S Sbjct: 32 IHWVHQLIDSELSLWREDLVRSLFPPYEAAIILGLPVSLTQARDRLVWHFTSSGSYELRS 91