BLASTX nr result
ID: Papaver22_contig00035436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00035436 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593126.1| Zinc finger MYM-type protein [Medicago trunc... 69 4e-10 ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the pro... 67 2e-09 ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the pro... 67 2e-09 ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the pro... 64 1e-08 dbj|BAA36225.1| transposase [Ipomoea purpurea] 62 5e-08 >ref|XP_003593126.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355482174|gb|AES63377.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 754 Score = 68.9 bits (167), Expect = 4e-10 Identities = 41/101 (40%), Positives = 51/101 (50%) Frame = +1 Query: 181 PSNDRNHEVPIVNHEHEEVGGQRTEFEAMSTQCEPEVVENAYLSSLERDPGLRMPIMQYP 360 P D N N E G Q + + + + +VEN ++ LERDPG R+ I +YP Sbjct: 43 PEEDANCIASTSNLEQNPSGDQTVQPDEQPCKIQRVIVENFDVNRLERDPGKRLQIWEYP 102 Query: 361 VNKRDEVRRAYLQMGRNVTRLAKYPGTLFGTQLRRFSAKWF 483 VN+RDEVRRAYL G KYP RRF A WF Sbjct: 103 VNQRDEVRRAYLNWGPYQWVAEKYP-LNEDKHPRRFQASWF 142 >ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355515798|gb|AES97421.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 796 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/68 (48%), Positives = 43/68 (63%) Frame = +1 Query: 280 EPEVVENAYLSSLERDPGLRMPIMQYPVNKRDEVRRAYLQMGRNVTRLAKYPGTLFGTQL 459 +P+ +EN SLERDPG R+PI QYP N++D +RRAYL+ G + L YP + G Sbjct: 52 DPDDIEN----SLERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNLENYPMSGIGKAQ 107 Query: 460 RRFSAKWF 483 RRF WF Sbjct: 108 RRFQHSWF 115 >ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355491187|gb|AES72390.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 785 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/68 (48%), Positives = 43/68 (63%) Frame = +1 Query: 280 EPEVVENAYLSSLERDPGLRMPIMQYPVNKRDEVRRAYLQMGRNVTRLAKYPGTLFGTQL 459 +P+ +EN SLERDPG R+PI QYP N++D +RRAYL+ G + L YP + G Sbjct: 15 DPDDIEN----SLERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNLENYPMSGIGKAQ 70 Query: 460 RRFSAKWF 483 RRF WF Sbjct: 71 RRFQHSWF 78 >ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|358348356|ref|XP_003638213.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355487453|gb|AES68656.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355504148|gb|AES85351.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 822 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = +1 Query: 280 EPEVVENAYLSSLERDPGLRMPIMQYPVNKRDEVRRAYLQMGRNVTRLAKYPGTLFGTQL 459 +P+ +EN SLERDPG +PI QYP N++D +RRAYL+ G + L YP + G Sbjct: 52 DPDDIEN----SLERDPGKCIPIYQYPPNQKDAIRRAYLKWGPYQSNLENYPMSGIGKAQ 107 Query: 460 RRFSAKWF 483 RRF WF Sbjct: 108 RRFQNSWF 115 >dbj|BAA36225.1| transposase [Ipomoea purpurea] Length = 808 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/66 (48%), Positives = 42/66 (63%) Frame = +1 Query: 286 EVVENAYLSSLERDPGLRMPIMQYPVNKRDEVRRAYLQMGRNVTRLAKYPGTLFGTQLRR 465 E+ E + +LERDPGLR+PI + P+ KRDEVRRAY++ G L+KYP + R Sbjct: 45 EINEKFDIQALERDPGLRLPIWKCPIEKRDEVRRAYIKAGPYQCLLSKYPKS-GEKHPRS 103 Query: 466 FSAKWF 483 F A WF Sbjct: 104 FQASWF 109