BLASTX nr result
ID: Papaver22_contig00033975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00033975 (507 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ70052.1| RIN4-like protein [Malus x domestica] 56 3e-06 >gb|ACJ70052.1| RIN4-like protein [Malus x domestica] Length = 239 Score = 56.2 bits (134), Expect = 3e-06 Identities = 41/129 (31%), Positives = 56/129 (43%) Frame = +1 Query: 103 KQRVTPSMATNDTPPRYDPKHTESISDSSHKPLDDPKTSVEEELPNDANTIDPVIKHSHE 282 ++ PS + ++ R P H + P + K S E A + Sbjct: 113 RRAARPSAGSENSVER-SPLHRNARVSGRDSPSWEGKASYESSHGTPARS---------R 162 Query: 283 LVRRPILPQRAAGVPKFGSWDAHDSSSGDGPDGFTWIFEKVREESSGKATSSESPGRQTT 462 L R P++ A VPKFG WD +D +S DGFT IF KVREE +GKA + S Sbjct: 163 LKPRDESPEKGAAVPKFGEWDENDPASA---DGFTHIFNKVREEKAGKAPGTPSHPSYQD 219 Query: 463 ISGNRSNES 489 SN+S Sbjct: 220 ARKQGSNDS 228