BLASTX nr result
ID: Papaver22_contig00032704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00032704 (563 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518800.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002305251.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 ref|XP_002333388.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 ref|XP_002267012.2| PREDICTED: uncharacterized protein LOC100267... 57 3e-06 emb|CBI22564.3| unnamed protein product [Vitis vinifera] 57 3e-06 >ref|XP_002518800.1| conserved hypothetical protein [Ricinus communis] gi|223542181|gb|EEF43725.1| conserved hypothetical protein [Ricinus communis] Length = 2820 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +1 Query: 1 IFNILPHMEIPRLAKNLDTIFGSYSIEKRWRCEFKCLEGELEVPMSW 141 +++ILP +IPRLAK LD IFGSY+ + RC+ KCLEG LEVP +W Sbjct: 980 VWDILPLEDIPRLAKRLDGIFGSYTDDFMNRCKEKCLEGNLEVPKTW 1026 >ref|XP_002305251.1| predicted protein [Populus trichocarpa] gi|222848215|gb|EEE85762.1| predicted protein [Populus trichocarpa] Length = 1011 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +1 Query: 1 IFNILPHMEIPRLAKNLDTIFGSYSIEKRWRCEFKCLEGELEVPMSW 141 +++ILP +IP+LA +LDT+F +Y+ E+ RC +KC+EG L VPM W Sbjct: 929 VWDILPSSDIPKLAPSLDTLFRNYTEEQMNRCLYKCMEGNLVVPMRW 975 >ref|XP_002333388.1| predicted protein [Populus trichocarpa] gi|222836389|gb|EEE74796.1| predicted protein [Populus trichocarpa] Length = 1087 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +1 Query: 1 IFNILPHMEIPRLAKNLDTIFGSYSIEKRWRCEFKCLEGELEVPMSW 141 +++ILP +IP+LA +LDT+F +Y+ E+ RC +KC+EG L VPM W Sbjct: 976 VWDILPSSDIPKLAMSLDTLFWNYTEEQMNRCLYKCMEGNLVVPMRW 1022 >ref|XP_002267012.2| PREDICTED: uncharacterized protein LOC100267290 [Vitis vinifera] Length = 1115 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/47 (46%), Positives = 34/47 (72%) Frame = +1 Query: 1 IFNILPHMEIPRLAKNLDTIFGSYSIEKRWRCEFKCLEGELEVPMSW 141 +++ILP E +LA+ L+T+ G+Y++ RC+ KC+EG LEVPM W Sbjct: 1034 VWDILPRSETSKLARRLETLLGNYTVNDMNRCKVKCIEGNLEVPMRW 1080 >emb|CBI22564.3| unnamed protein product [Vitis vinifera] Length = 944 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/47 (46%), Positives = 34/47 (72%) Frame = +1 Query: 1 IFNILPHMEIPRLAKNLDTIFGSYSIEKRWRCEFKCLEGELEVPMSW 141 +++ILP E +LA+ L+T+ G+Y++ RC+ KC+EG LEVPM W Sbjct: 863 VWDILPRSETSKLARRLETLLGNYTVNDMNRCKVKCIEGNLEVPMRW 909