BLASTX nr result
ID: Papaver22_contig00031693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00031693 (551 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522657.1| sentrin/sumo-specific protease, putative [Ri... 59 7e-07 >ref|XP_002522657.1| sentrin/sumo-specific protease, putative [Ricinus communis] gi|223538133|gb|EEF39744.1| sentrin/sumo-specific protease, putative [Ricinus communis] Length = 887 Score = 58.5 bits (140), Expect = 7e-07 Identities = 38/134 (28%), Positives = 67/134 (50%), Gaps = 5/134 (3%) Frame = -3 Query: 399 INTEVVLSPHSLKYMGNHVNKRNCSEFSLSFTRSYIKLEITNSYKRRLLPRFKWEISQVS 220 +N VV+ P + Y + C+E L+F+ S+I++E + +W I+ + Sbjct: 215 LNNAVVVFPDFILYGDIY-----CTESCLTFSSSHIRVEGLTINGSKGSFNAEWAIADIV 269 Query: 219 SIK--WYSLGYDVHLKLCRRPNTVKEAG---DDPGLLEYKLLVYDVLWFQTQERINALDE 55 SI+ W +KL +PN + G + G+ E K+ VYD W + QE I +LD Sbjct: 270 SIESEWCGRVETAMIKLHLKPNVSESVGNSNESSGIDELKVSVYDPCWSEGQEAIKSLDV 329 Query: 54 IYKALWEFVLDNDR 13 Y+ +W ++D+D+ Sbjct: 330 RYRDIWNVIIDSDQ 343