BLASTX nr result
ID: Papaver22_contig00028805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00028805 (697 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002889773.1| hypothetical protein ARALYDRAFT_471096 [Arab... 46 2e-07 gb|AAK71314.1|AF388175_1 papain-like cysteine peptidase XBCP3 [A... 46 2e-07 ref|XP_002510459.1| cysteine protease, putative [Ricinus communi... 45 2e-07 dbj|BAJ53169.1| JHL18I08.3 [Jatropha curcas] 47 4e-07 ref|NP_563855.1| xylem bark cysteine peptidase 3 [Arabidopsis th... 46 6e-07 >ref|XP_002889773.1| hypothetical protein ARALYDRAFT_471096 [Arabidopsis lyrata subsp. lyrata] gi|297335615|gb|EFH66032.1| hypothetical protein ARALYDRAFT_471096 [Arabidopsis lyrata subsp. lyrata] Length = 439 Score = 46.2 bits (108), Expect(3) = 2e-07 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +3 Query: 240 FGVPCSTPLDHVVLIVGYESEDAVDNWFLKTHEEQIW 350 F PCST LDH VLIVGY S++ VD W +K + W Sbjct: 270 FSGPCSTSLDHAVLIVGYGSQNGVDYWIVKNSWGKSW 306 Score = 32.0 bits (71), Expect(3) = 2e-07 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 136 RTSNEKDLPRAVLTQQVSESKCGSTATFPLYSR 234 ++++EK L AV Q VS CGS F LYSR Sbjct: 233 KSNDEKALREAVAAQPVSVGICGSERAFQLYSR 265 Score = 22.3 bits (46), Expect(3) = 2e-07 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +3 Query: 3 VVDCDKSCNSG-----VQYSISFTL 62 ++DCDKS N+G + Y+ F + Sbjct: 170 LIDCDKSYNAGCNGGLMDYAFEFVI 194 >gb|AAK71314.1|AF388175_1 papain-like cysteine peptidase XBCP3 [Arabidopsis thaliana] Length = 437 Score = 46.2 bits (108), Expect(3) = 2e-07 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +3 Query: 240 FGVPCSTPLDHVVLIVGYESEDAVDNWFLKTHEEQIW 350 F PCST LDH VLIVGY S++ VD W +K + W Sbjct: 268 FSGPCSTSLDHAVLIVGYGSQNGVDYWIVKNSWGKSW 304 Score = 32.0 bits (71), Expect(3) = 2e-07 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 136 RTSNEKDLPRAVLTQQVSESKCGSTATFPLYSR 234 ++++EK L AV Q VS CGS F LYSR Sbjct: 233 KSNDEKALMEAVAAQPVSVGICGSERAFQLYSR 265 Score = 22.3 bits (46), Expect(3) = 2e-07 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +3 Query: 3 VVDCDKSCNSG-----VQYSISFTL 62 ++DCDKS N+G + Y+ F + Sbjct: 170 LIDCDKSYNAGCNGGLMDYAFEFVI 194 >ref|XP_002510459.1| cysteine protease, putative [Ricinus communis] gi|223551160|gb|EEF52646.1| cysteine protease, putative [Ricinus communis] Length = 422 Score = 45.4 bits (106), Expect(3) = 2e-07 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = +3 Query: 240 FGVPCSTPLDHVVLIVGYESEDAVDNWFLKTHEEQIW 350 F PCST LDH VLIVGY SE+ VD W +K W Sbjct: 269 FTGPCSTSLDHAVLIVGYGSENGVDYWIVKNSWGTHW 305 Score = 33.5 bits (75), Expect(3) = 2e-07 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +1 Query: 142 SNEKDLPRAVLTQQVSESKCGSTATFPLYSR 234 +NEK+L +AV Q VS CGS F LYS+ Sbjct: 236 NNEKELLKAVAAQPVSVGICGSERAFQLYSK 266 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 116 TIDGYTDV 139 TIDGYTDV Sbjct: 226 TIDGYTDV 233 >dbj|BAJ53169.1| JHL18I08.3 [Jatropha curcas] Length = 441 Score = 46.6 bits (109), Expect(2) = 4e-07 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = +3 Query: 240 FGVPCSTPLDHVVLIVGYESEDAVDNWFLKTHEEQIW 350 F PCST LDH VLIVGY SE+ VD W +K W Sbjct: 268 FTGPCSTSLDHAVLIVGYGSENGVDYWIVKNSWGSYW 304 Score = 33.5 bits (75), Expect(2) = 4e-07 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +1 Query: 142 SNEKDLPRAVLTQQVSESKCGSTATFPLYSR 234 +NEK+L +AV Q VS CGS F LYS+ Sbjct: 235 NNEKELLKAVANQPVSVGICGSERAFQLYSK 265 >ref|NP_563855.1| xylem bark cysteine peptidase 3 [Arabidopsis thaliana] gi|110741821|dbj|BAE98853.1| papain-like cysteine peptidase XBCP3 [Arabidopsis thaliana] gi|111074448|gb|ABH04597.1| At1g09850 [Arabidopsis thaliana] gi|332190386|gb|AEE28507.1| xylem bark cysteine peptidase 3 [Arabidopsis thaliana] Length = 437 Score = 46.2 bits (108), Expect(3) = 6e-07 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +3 Query: 240 FGVPCSTPLDHVVLIVGYESEDAVDNWFLKTHEEQIW 350 F PCST LDH VLIVGY S++ VD W +K + W Sbjct: 268 FSGPCSTSLDHAVLIVGYGSQNGVDYWIVKNSWGKSW 304 Score = 30.0 bits (66), Expect(3) = 6e-07 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 136 RTSNEKDLPRAVLTQQVSESKCGSTATFPLYS 231 ++++EK L AV Q VS CGS F LYS Sbjct: 233 KSNDEKALMEAVAAQPVSVGICGSERAFQLYS 264 Score = 22.3 bits (46), Expect(3) = 6e-07 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +3 Query: 3 VVDCDKSCNSG-----VQYSISFTL 62 ++DCDKS N+G + Y+ F + Sbjct: 170 LIDCDKSYNAGCNGGLMDYAFEFVI 194