BLASTX nr result
ID: Papaver22_contig00024188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00024188 (2089 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35838.3| unnamed protein product [Vitis vinifera] 55 5e-06 >emb|CBI35838.3| unnamed protein product [Vitis vinifera] Length = 895 Score = 55.1 bits (131), Expect(2) = 5e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +2 Query: 1940 LFREFAMISMWKVPKYPV*ANMLLSFLAQPLKHPKEGHNA*E 2065 LFREF++ISMW+VP PV A+ LLSFLA+PLK P E +A E Sbjct: 557 LFREFSLISMWRVPAMPVGAHTLLSFLAEPLKQPPETLHAFE 598 Score = 23.5 bits (49), Expect(2) = 5e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 2061 ENLQEFQDW 2087 ENL+EFQDW Sbjct: 604 ENLKEFQDW 612