BLASTX nr result
ID: Papaver22_contig00024014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00024014 (1025 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus... 65 3e-08 ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B... 62 2e-07 ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 f... 62 2e-07 ref|XP_002276080.1| PREDICTED: 60S ribosomal protein L51, mitoch... 61 5e-07 ref|XP_003550025.1| PREDICTED: 60S ribosomal protein L51, mitoch... 60 1e-06 >ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus communis] gi|223529875|gb|EEF31806.1| 60S ribosomal protein L51, putative [Ricinus communis] Length = 119 Score = 65.1 bits (157), Expect = 3e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 910 REFMKSELPAFKEGNPQLEVVSELNRGRHPFLKALYKN 1023 R FM+S LP FKEGNPQLEV++ELNRG+HP LK YKN Sbjct: 27 RAFMESHLPVFKEGNPQLEVITELNRGQHPLLKGFYKN 64 >ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|297322355|gb|EFH52776.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] Length = 119 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +1 Query: 910 REFMKSELPAFKEGNPQLEVVSELNRGRHPFLKALYKN 1023 R FM+SELPA KE NPQLEVV+EL+RG+HP+LK +Y+N Sbjct: 27 RAFMESELPALKEKNPQLEVVTELSRGQHPYLKGIYRN 64 >ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|6996301|emb|CAB75462.1| putative protein [Arabidopsis thaliana] gi|21617971|gb|AAM67021.1| unknown [Arabidopsis thaliana] gi|27808540|gb|AAO24550.1| At3g59650 [Arabidopsis thaliana] gi|110743592|dbj|BAE99633.1| hypothetical protein [Arabidopsis thaliana] gi|332646429|gb|AEE79950.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 119 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +1 Query: 910 REFMKSELPAFKEGNPQLEVVSELNRGRHPFLKALYKN 1023 R FM+SELPA KE NPQLEV++EL+RG+HP+LK +Y+N Sbjct: 27 RAFMESELPALKEKNPQLEVITELSRGQHPYLKGIYRN 64 >ref|XP_002276080.1| PREDICTED: 60S ribosomal protein L51, mitochondrial isoform 1 [Vitis vinifera] gi|225434100|ref|XP_002276106.1| PREDICTED: 60S ribosomal protein L51, mitochondrial isoform 2 [Vitis vinifera] gi|147861396|emb|CAN83982.1| hypothetical protein VITISV_001097 [Vitis vinifera] gi|296084281|emb|CBI24669.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 910 REFMKSELPAFKEGNPQLEVVSELNRGRHPFLKALYKN 1023 R FM+S LPAFKE NPQLEVV+EL RG+HP LK YKN Sbjct: 27 RAFMESHLPAFKESNPQLEVVTELIRGQHPHLKGFYKN 64 >ref|XP_003550025.1| PREDICTED: 60S ribosomal protein L51, mitochondrial-like [Glycine max] Length = 119 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 910 REFMKSELPAFKEGNPQLEVVSELNRGRHPFLKALYKN 1023 R FM+S LP FKE NPQLEVV+EL RG+HP LKA YKN Sbjct: 27 RAFMESHLPTFKEKNPQLEVVTELIRGQHPHLKAYYKN 64