BLASTX nr result
ID: Papaver22_contig00022228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00022228 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002877160.1| hypothetical protein ARALYDRAFT_905208 [Arab... 70 2e-10 ref|XP_002460961.1| hypothetical protein SORBIDRAFT_02g038255 [S... 70 2e-10 ref|NP_566844.1| uncharacterized protein [Arabidopsis thaliana] ... 70 2e-10 ref|XP_003562379.1| PREDICTED: UPF0414 transmembrane protein C20... 68 7e-10 dbj|BAK00617.1| predicted protein [Hordeum vulgare subsp. vulgare] 68 7e-10 >ref|XP_002877160.1| hypothetical protein ARALYDRAFT_905208 [Arabidopsis lyrata subsp. lyrata] gi|297322998|gb|EFH53419.1| hypothetical protein ARALYDRAFT_905208 [Arabidopsis lyrata subsp. lyrata] Length = 121 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 9 LGVLAFLPGFYETRIAYYSWRGAQGYRFASIPGY 110 LG+L FLPGFYETRIAYYSWRGA+GYRFA+IP Y Sbjct: 88 LGILTFLPGFYETRIAYYSWRGAEGYRFAAIPSY 121 >ref|XP_002460961.1| hypothetical protein SORBIDRAFT_02g038255 [Sorghum bicolor] gi|241924338|gb|EER97482.1| hypothetical protein SORBIDRAFT_02g038255 [Sorghum bicolor] Length = 93 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 9 LGVLAFLPGFYETRIAYYSWRGAQGYRFASIPGY 110 LGVLAFLPG+YETR+AYYSWRGAQGY FASIP Y Sbjct: 60 LGVLAFLPGYYETRVAYYSWRGAQGYTFASIPDY 93 >ref|NP_566844.1| uncharacterized protein [Arabidopsis thaliana] gi|9294037|dbj|BAB01994.1| unnamed protein product [Arabidopsis thaliana] gi|21537038|gb|AAM61379.1| unknown [Arabidopsis thaliana] gi|51971585|dbj|BAD44457.1| unknown protein [Arabidopsis thaliana] gi|51971745|dbj|BAD44537.1| unknown protein [Arabidopsis thaliana] gi|114050555|gb|ABI49427.1| At3g29170 [Arabidopsis thaliana] gi|332644024|gb|AEE77545.1| uncharacterized protein [Arabidopsis thaliana] Length = 121 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 9 LGVLAFLPGFYETRIAYYSWRGAQGYRFASIPGY 110 LG+L FLPGFYETRIAYYSWRGA+GYRFA+IP Y Sbjct: 88 LGILTFLPGFYETRIAYYSWRGAEGYRFAAIPSY 121 >ref|XP_003562379.1| PREDICTED: UPF0414 transmembrane protein C20orf30-like [Brachypodium distachyon] Length = 112 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 9 LGVLAFLPGFYETRIAYYSWRGAQGYRFASIPGY 110 LG+LAFLPGFYETR+AYYSWRGA GY FASIP Y Sbjct: 79 LGILAFLPGFYETRVAYYSWRGAPGYTFASIPDY 112 >dbj|BAK00617.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 112 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 9 LGVLAFLPGFYETRIAYYSWRGAQGYRFASIPGY 110 LG+LAFLPGFYETR+AYYSWRGA GY FASIP Y Sbjct: 79 LGILAFLPGFYETRVAYYSWRGAPGYTFASIPDY 112