BLASTX nr result
ID: Papaver22_contig00022118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00022118 (606 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316423.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002311041.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_004142455.1| PREDICTED: OTU domain-containing protein At3... 59 9e-07 ref|XP_002530891.1| cysteine-type peptidase, putative [Ricinus c... 58 1e-06 gb|EEE69947.1| hypothetical protein OsJ_29825 [Oryza sativa Japo... 57 2e-06 >ref|XP_002316423.1| predicted protein [Populus trichocarpa] gi|222865463|gb|EEF02594.1| predicted protein [Populus trichocarpa] Length = 318 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -1 Query: 606 RRRNEFDQWDLGDFDDYVKRMRDPTEWGGEPELLMASHVLRVVCAAELR 460 +RR E + + GDFD YVKR++ P WGGEPELLMASHVL+ + + +R Sbjct: 219 KRREETEWFIEGDFDAYVKRIQQPYVWGGEPELLMASHVLKTMISVFMR 267 >ref|XP_002311041.1| predicted protein [Populus trichocarpa] gi|222850861|gb|EEE88408.1| predicted protein [Populus trichocarpa] Length = 326 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -1 Query: 606 RRRNEFDQWDLGDFDDYVKRMRDPTEWGGEPELLMASHVLRVVCAAELR 460 +RR E + + GDFD YVKR++ P WGGEPELLMASHVL+ + + +R Sbjct: 227 KRREETEWFIEGDFDAYVKRIQQPYVWGGEPELLMASHVLKTMISVFMR 275 >ref|XP_004142455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449520841|ref|XP_004167441.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 313 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 606 RRRNEFDQWDLGDFDDYVKRMRDPTEWGGEPELLMASHVLRVVCAAELR 460 +RR E + + GDFD YVKR++ P WGGEPELLMASHVL+ + +R Sbjct: 214 KRRKETEWYIEGDFDAYVKRIQQPFVWGGEPELLMASHVLKTPISVFMR 262 >ref|XP_002530891.1| cysteine-type peptidase, putative [Ricinus communis] gi|223529544|gb|EEF31497.1| cysteine-type peptidase, putative [Ricinus communis] Length = 185 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 606 RRRNEFDQWDLGDFDDYVKRMRDPTEWGGEPELLMASHVLRVV 478 +RR E + + GDFD YVKR++ P WGGEPELLMASHVL+ + Sbjct: 87 KRREETEWFIEGDFDAYVKRIQQPYVWGGEPELLMASHVLKTM 129 >gb|EEE69947.1| hypothetical protein OsJ_29825 [Oryza sativa Japonica Group] Length = 369 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 606 RRRNEFDQWDLGDFDDYVKRMRDPTEWGGEPELLMASHVLRV 481 +RR E + + GDFD YV R+R P WGGEPELLMASHVLR+ Sbjct: 273 KRRAETEWFVEGDFDAYVSRIRKPHVWGGEPELLMASHVLRM 314