BLASTX nr result
ID: Papaver22_contig00022084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00022084 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274410.1| PREDICTED: BRO1 domain-containing protein BR... 53 2e-06 emb|CAN77742.1| hypothetical protein VITISV_043319 [Vitis vinifera] 53 5e-06 >ref|XP_002274410.1| PREDICTED: BRO1 domain-containing protein BROX homolog isoform 1 [Vitis vinifera] gi|296082294|emb|CBI21299.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 22/42 (52%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 374 VSEERRLACEQLAYYAQAHFCLSASNLTEEYGKS---FIRWK 490 +S +RRLACEQ++Y++QAH+CLS +++ YGK FI+WK Sbjct: 232 LSVKRRLACEQMSYFSQAHYCLSGCDMSHGYGKKHLLFIKWK 273 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 348 AVESIKATLSVKR 386 AVES KATLSVKR Sbjct: 224 AVESQKATLSVKR 236 >emb|CAN77742.1| hypothetical protein VITISV_043319 [Vitis vinifera] Length = 394 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 22/42 (52%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 374 VSEERRLACEQLAYYAQAHFCLSASNLTEEYGKS---FIRWK 490 +S +RRLACEQ++Y++QAH+CLS +++ YGK FI+WK Sbjct: 207 LSVKRRLACEQMSYFSQAHYCLSGCDMSHGYGKKHLLFIKWK 248 Score = 22.3 bits (46), Expect(2) = 5e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 348 AVESIKATLSVKR 386 AVES K TLSVKR Sbjct: 199 AVESQKVTLSVKR 211