BLASTX nr result
ID: Papaver22_contig00022042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00022042 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304436.1| predicted protein [Populus trichocarpa] gi|2... 54 5e-07 ref|XP_002509613.1| immature colon carcinoma transcript, putativ... 49 9e-06 >ref|XP_002304436.1| predicted protein [Populus trichocarpa] gi|222841868|gb|EEE79415.1| predicted protein [Populus trichocarpa] Length = 229 Score = 53.5 bits (127), Expect(2) = 5e-07 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 493 ICFGRIVCMASDASSEKKMSSRLSQVNQFIQEAEERASAAAGNEP 359 I F RI C SD +KK+SSRLSQV Q +QEAEERAS AAGNEP Sbjct: 49 ISFSRIKCAGSD---DKKVSSRLSQVQQLLQEAEERAS-AAGNEP 89 Score = 25.4 bits (54), Expect(2) = 5e-07 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 278 VSLDLVIVSFATSGGP 231 ++LD V VSFA SGGP Sbjct: 93 ITLDHVTVSFARSGGP 108 >ref|XP_002509613.1| immature colon carcinoma transcript, putative [Ricinus communis] gi|223549512|gb|EEF51000.1| immature colon carcinoma transcript, putative [Ricinus communis] Length = 234 Score = 49.3 bits (116), Expect(2) = 9e-06 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -3 Query: 547 ITPWTLMRFNGIIGCTLSICFGRIVCMASDASSEKKMSSRLSQVNQFIQEAEERASAAAG 368 +TP T + N + + F RI C ASD +KK+S+RLSQV Q +QEAEE+A +AG Sbjct: 37 LTP-TNLHANAVKFTRRELSFSRIRCAASD---DKKVSARLSQVQQLLQEAEEQA-ISAG 91 Query: 367 NEP 359 NEP Sbjct: 92 NEP 94 Score = 25.4 bits (54), Expect(2) = 9e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 278 VSLDLVIVSFATSGGP 231 ++LD V VSFA SGGP Sbjct: 98 ITLDHVTVSFARSGGP 113