BLASTX nr result
ID: Papaver22_contig00019249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00019249 (862 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKV47900.1| hypothetical protein AGABI2DRAFT_116714 [Agaricus... 65 3e-08 gb|EKM74497.1| hypothetical protein AGABI1DRAFT_47875, partial [... 65 3e-08 gb|EEC82986.1| hypothetical protein OsI_28021 [Oryza sativa Indi... 59 2e-06 gb|EIW56296.1| hypothetical protein TRAVEDRAFT_150795, partial [... 56 9e-06 >gb|EKV47900.1| hypothetical protein AGABI2DRAFT_116714 [Agaricus bisporus var. bisporus H97] Length = 357 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/59 (47%), Positives = 40/59 (67%) Frame = +2 Query: 680 RHFLGEMNVICQHCGAMHFMEERLARPSFKNRAFGSCFLQGKVKLPNLIVPPQRLKELY 856 RH LG MNV C HCGA+H++ E+LAR S + FG C +G++ LP PP+ ++EL+ Sbjct: 31 RHSLGPMNVACAHCGALHWIGEKLARSSDHSPKFGMCCHEGQISLPQRQDPPRHIQELF 89 >gb|EKM74497.1| hypothetical protein AGABI1DRAFT_47875, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 171 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/59 (47%), Positives = 40/59 (67%) Frame = +2 Query: 680 RHFLGEMNVICQHCGAMHFMEERLARPSFKNRAFGSCFLQGKVKLPNLIVPPQRLKELY 856 RH LG MNV C HCGA+H++ E+LAR S + FG C +G++ LP PP+ ++EL+ Sbjct: 31 RHSLGPMNVACAHCGALHWIGEKLARSSDHSPKFGMCCHEGQISLPQRQDPPRHIQELF 89 >gb|EEC82986.1| hypothetical protein OsI_28021 [Oryza sativa Indica Group] Length = 937 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/70 (47%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = +2 Query: 656 NTNLKSKVRHFLGEMNVICQHCGAMHFMEERL-ARPSFKNRAFGSCFLQGKVKLPNLIVP 832 +T + S++ +F G+ ICQHC A+ + EERL + S N +FG C QGK+KLP L P Sbjct: 83 STIVHSQIWNF-GKPTYICQHCNALLWYEERLNSNKSTTNPSFGMCCKQGKIKLPPLKEP 141 Query: 833 PQRLKELYEG 862 PQ LK L G Sbjct: 142 PQYLKRLLTG 151 >gb|EIW56296.1| hypothetical protein TRAVEDRAFT_150795, partial [Trametes versicolor FP-101664 SS1] Length = 490 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +2 Query: 683 HFLGEMNVICQHCGAMHFMEERLARPSFKNRAFGSCFLQGKVKLPNLIVPPQRLKELYEG 862 H LG M+V C CGA+H+++ERL++ + + FG C G+V LP L PP L++L G Sbjct: 199 HTLGRMDVECSICGALHWLDERLSKSTATSPRFGFCCDSGRVLLPALPPPPPLLRQLLSG 258