BLASTX nr result
ID: Papaver22_contig00018101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00018101 (767 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA42475.1| TPA: hypothetical protein ZEAMMB73_247711 [Zea m... 65 2e-08 tpg|DAA42474.1| TPA: hypothetical protein ZEAMMB73_247711 [Zea m... 63 6e-08 ref|XP_002461627.1| hypothetical protein SORBIDRAFT_02g005710 [S... 63 6e-08 ref|XP_002516593.1| hypothetical protein RCOM_0803470 [Ricinus c... 63 6e-08 ref|XP_002511495.1| tRNA ligase, putative [Ricinus communis] gi|... 63 8e-08 >tpg|DAA42475.1| TPA: hypothetical protein ZEAMMB73_247711 [Zea mays] Length = 381 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +3 Query: 576 LQKKERALKRQQTQVMLLHGFLNSHHIGANLPQRNRKPVSYTFDDYDQSIDEALQI 743 +QKKER LK+QQ + +LL +L S + R+RKPV+YTFDDYD+SI+EA++I Sbjct: 1 MQKKERLLKKQQREALLLDSYLTSDGLTTGRSLRDRKPVTYTFDDYDRSINEAIKI 56 >tpg|DAA42474.1| TPA: hypothetical protein ZEAMMB73_247711 [Zea mays] Length = 759 Score = 63.2 bits (152), Expect = 6e-08 Identities = 31/64 (48%), Positives = 43/64 (67%) Frame = +3 Query: 552 YLACTHAFLQKKERALKRQQTQVMLLHGFLNSHHIGANLPQRNRKPVSYTFDDYDQSIDE 731 YL +KKER LK+QQ + +LL +L S + R+RKPV+YTFDDYD+SI+E Sbjct: 371 YLPEIEKIHKKKERLLKKQQREALLLDSYLTSDGLTTGRSLRDRKPVTYTFDDYDRSINE 430 Query: 732 ALQI 743 A++I Sbjct: 431 AIKI 434 >ref|XP_002461627.1| hypothetical protein SORBIDRAFT_02g005710 [Sorghum bicolor] gi|241925004|gb|EER98148.1| hypothetical protein SORBIDRAFT_02g005710 [Sorghum bicolor] Length = 625 Score = 63.2 bits (152), Expect = 6e-08 Identities = 31/64 (48%), Positives = 43/64 (67%) Frame = +3 Query: 552 YLACTHAFLQKKERALKRQQTQVMLLHGFLNSHHIGANLPQRNRKPVSYTFDDYDQSIDE 731 YL +KKER LK+QQ + +LL +L S + R+RKPV+YTFDDYD+SI+E Sbjct: 235 YLPEIEKIHKKKERLLKKQQREALLLDSYLTSDGLTTGRSLRDRKPVTYTFDDYDRSINE 294 Query: 732 ALQI 743 A++I Sbjct: 295 AIKI 298 >ref|XP_002516593.1| hypothetical protein RCOM_0803470 [Ricinus communis] gi|223544413|gb|EEF45934.1| hypothetical protein RCOM_0803470 [Ricinus communis] Length = 485 Score = 63.2 bits (152), Expect = 6e-08 Identities = 31/64 (48%), Positives = 45/64 (70%) Frame = +3 Query: 552 YLACTHAFLQKKERALKRQQTQVMLLHGFLNSHHIGANLPQRNRKPVSYTFDDYDQSIDE 731 +L F +KKERALK++Q Q LL+ F S+ G R+R+P+SYTFDDYD++IDE Sbjct: 239 FLPLVEKFQKKKERALKQKQRQERLLNDF-TSYGTGITRSCRSRRPISYTFDDYDRAIDE 297 Query: 732 ALQI 743 A+++ Sbjct: 298 AIEV 301 >ref|XP_002511495.1| tRNA ligase, putative [Ricinus communis] gi|223550610|gb|EEF52097.1| tRNA ligase, putative [Ricinus communis] Length = 721 Score = 62.8 bits (151), Expect = 8e-08 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +3 Query: 579 QKKERALKRQQTQVMLLHGFLNSHHIGANLPQRNRKPVSYTFDDYDQSIDEALQI 743 ++KER LK+Q Q +LL FL+ +G R+RKPV+YTFDDYD+SI+EA++I Sbjct: 354 KRKERLLKKQHRQALLLDNFLSVDGLGPGRSLRDRKPVTYTFDDYDRSINEAIKI 408