BLASTX nr result
ID: Papaver22_contig00018006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00018006 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144057.1| PREDICTED: DNA repair protein RAD51 homolog ... 63 4e-10 ref|XP_002273803.1| PREDICTED: DNA repair protein RAD51 homolog ... 62 2e-09 ref|XP_002516197.1| DNA repair protein rad51, putative [Ricinus ... 62 2e-09 ref|XP_002449862.1| hypothetical protein SORBIDRAFT_05g024565 [S... 61 5e-09 ref|XP_002463076.1| hypothetical protein SORBIDRAFT_02g037320 [S... 60 6e-09 >ref|XP_004144057.1| PREDICTED: DNA repair protein RAD51 homolog [Cucumis sativus] gi|449518135|ref|XP_004166099.1| PREDICTED: DNA repair protein RAD51 homolog [Cucumis sativus] Length = 340 Score = 63.2 bits (152), Expect(2) = 4e-10 Identities = 40/81 (49%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +3 Query: 30 LRSFQLPSQSRELDTVFEGGTKT*SLNESYGEFRRGKPQLCYTFARHLSTSPDQLSW*RK 209 L QL S SRELD + EGG +T S+ E YGEFR GK QLC+T DQ K Sbjct: 98 LEIIQLTSGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGK 157 Query: 210 SSVH*CQGTFCP-*LLQIADR 269 + +GTF P LLQIADR Sbjct: 158 AMYIDAEGTFRPQRLLQIADR 178 Score = 26.2 bits (56), Expect(2) = 4e-10 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 2 SAGQLHPQMLEIIPVT 49 SAGQLH Q LEII +T Sbjct: 89 SAGQLHAQRLEIIQLT 104 >ref|XP_002273803.1| PREDICTED: DNA repair protein RAD51 homolog [Vitis vinifera] gi|297738498|emb|CBI27743.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 62.4 bits (150), Expect(2) = 2e-09 Identities = 39/81 (48%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +3 Query: 30 LRSFQLPSQSRELDTVFEGGTKT*SLNESYGEFRRGKPQLCYTFARHLSTSPDQLSW*RK 209 L Q+ S SRELD + EGG +T S+ E YGEFR GK QLC+T DQ K Sbjct: 95 LEIIQITSGSRELDKILEGGLETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGK 154 Query: 210 SSVH*CQGTFCP-*LLQIADR 269 + +GTF P LLQIADR Sbjct: 155 AMYIDAEGTFRPQRLLQIADR 175 Score = 24.6 bits (52), Expect(2) = 2e-09 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 2 SAGQLHPQMLEIIPVT 49 SA QLH Q LEII +T Sbjct: 86 SASQLHAQRLEIIQIT 101 >ref|XP_002516197.1| DNA repair protein rad51, putative [Ricinus communis] gi|223544683|gb|EEF46199.1| DNA repair protein rad51, putative [Ricinus communis] Length = 294 Score = 62.4 bits (150), Expect(2) = 2e-09 Identities = 39/81 (48%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +3 Query: 30 LRSFQLPSQSRELDTVFEGGTKT*SLNESYGEFRRGKPQLCYTFARHLSTSPDQLSW*RK 209 L Q+ S SRELD + EGG +T S+ E YGEFR GK QLC+T DQ K Sbjct: 99 LEIIQITSGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGK 158 Query: 210 SSVH*CQGTFCP-*LLQIADR 269 + +GTF P LLQIADR Sbjct: 159 AMYIDAEGTFRPQRLLQIADR 179 Score = 24.6 bits (52), Expect(2) = 2e-09 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 2 SAGQLHPQMLEIIPVT 49 SA QLH Q LEII +T Sbjct: 90 SASQLHAQRLEIIQIT 105 >ref|XP_002449862.1| hypothetical protein SORBIDRAFT_05g024565 [Sorghum bicolor] gi|241935705|gb|EES08850.1| hypothetical protein SORBIDRAFT_05g024565 [Sorghum bicolor] Length = 340 Score = 60.8 bits (146), Expect(2) = 5e-09 Identities = 38/81 (46%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +3 Query: 30 LRSFQLPSQSRELDTVFEGGTKT*SLNESYGEFRRGKPQLCYTFARHLSTSPDQLSW*RK 209 L Q+ + SRELD + EGG +T S+ E YGEFR GK QLC+T DQ K Sbjct: 95 LEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGK 154 Query: 210 SSVH*CQGTFCP-*LLQIADR 269 + +GTF P LLQIADR Sbjct: 155 AMYIDAEGTFRPQRLLQIADR 175 Score = 25.0 bits (53), Expect(2) = 5e-09 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 2 SAGQLHPQMLEIIPVT 49 SA QLH Q LEII VT Sbjct: 86 SASQLHAQRLEIIQVT 101 >ref|XP_002463076.1| hypothetical protein SORBIDRAFT_02g037320 [Sorghum bicolor] gi|241926453|gb|EER99597.1| hypothetical protein SORBIDRAFT_02g037320 [Sorghum bicolor] Length = 344 Score = 60.5 bits (145), Expect(2) = 6e-09 Identities = 38/81 (46%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +3 Query: 30 LRSFQLPSQSRELDTVFEGGTKT*SLNESYGEFRRGKPQLCYTFARHLSTSPDQLSW*RK 209 L Q+ + SRELD + EGG +T S+ E YGEFR GK QLC+T DQ K Sbjct: 102 LEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGK 161 Query: 210 SSVH*CQGTFCP-*LLQIADR 269 + +GTF P LLQIADR Sbjct: 162 ALYIDAEGTFRPQRLLQIADR 182 Score = 25.0 bits (53), Expect(2) = 6e-09 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 2 SAGQLHPQMLEIIPVT 49 SA QLH Q LEII VT Sbjct: 93 SASQLHAQRLEIIQVT 108