BLASTX nr result
ID: Papaver22_contig00017235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00017235 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597914.1| Pre-mRNA-processing-splicing factor [Medicag... 78 6e-13 ref|XP_003626843.1| Pre-mRNA splicing factor [Medicago truncatul... 78 6e-13 ref|XP_003632761.1| PREDICTED: pre-mRNA-processing-splicing fact... 77 1e-12 ref|XP_003632762.1| PREDICTED: pre-mRNA-processing-splicing fact... 77 1e-12 emb|CAN66492.1| hypothetical protein VITISV_019851 [Vitis vinifera] 77 1e-12 >ref|XP_003597914.1| Pre-mRNA-processing-splicing factor [Medicago truncatula] gi|355486962|gb|AES68165.1| Pre-mRNA-processing-splicing factor [Medicago truncatula] Length = 2398 Score = 78.2 bits (191), Expect = 6e-13 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +3 Query: 3 IKLGTPREYYHEDHRPTHYLDFSNIEEGDNLAEGDREDKFT 125 +KLGTPREYYHEDHRPTH+L+FSN+EEG+ + EGDRED F+ Sbjct: 2358 VKLGTPREYYHEDHRPTHFLEFSNMEEGETITEGDREDTFS 2398 >ref|XP_003626843.1| Pre-mRNA splicing factor [Medicago truncatula] gi|355520865|gb|AET01319.1| Pre-mRNA splicing factor [Medicago truncatula] Length = 2337 Score = 78.2 bits (191), Expect = 6e-13 Identities = 31/41 (75%), Positives = 39/41 (95%) Frame = +3 Query: 3 IKLGTPREYYHEDHRPTHYLDFSNIEEGDNLAEGDREDKFT 125 +KLGTPREYYHEDHRPTH+L+FSN+EEG+ +A+GDRED F+ Sbjct: 2297 VKLGTPREYYHEDHRPTHFLEFSNMEEGETIAKGDREDTFS 2337 >ref|XP_003632761.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like isoform 1 [Vitis vinifera] Length = 2367 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 IKLGTPREYYHEDHRPTHYLDFSNIEEGDNLAEGDREDKFT 125 IKLGTPREYYHEDHRPTH+L+FSN+EEG+ +AEGDRED FT Sbjct: 2328 IKLGTPREYYHEDHRPTHFLEFSNLEEGE-MAEGDREDTFT 2367 >ref|XP_003632762.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like isoform 2 [Vitis vinifera] gi|297743472|emb|CBI36339.3| unnamed protein product [Vitis vinifera] Length = 2347 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 IKLGTPREYYHEDHRPTHYLDFSNIEEGDNLAEGDREDKFT 125 IKLGTPREYYHEDHRPTH+L+FSN+EEG+ +AEGDRED FT Sbjct: 2308 IKLGTPREYYHEDHRPTHFLEFSNLEEGE-MAEGDREDTFT 2347 >emb|CAN66492.1| hypothetical protein VITISV_019851 [Vitis vinifera] Length = 2294 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 IKLGTPREYYHEDHRPTHYLDFSNIEEGDNLAEGDREDKFT 125 IKLGTPREYYHEDHRPTH+L+FSN+EEG+ +AEGDRED FT Sbjct: 2255 IKLGTPREYYHEDHRPTHFLEFSNLEEGE-MAEGDREDTFT 2294