BLASTX nr result
ID: Papaver22_contig00017185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00017185 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541149.1| PREDICTED: calreticulin-3-like [Glycine max] 69 1e-09 ref|XP_002456774.1| hypothetical protein SORBIDRAFT_03g042500 [S... 69 1e-09 emb|CBI17604.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_002276433.1| PREDICTED: calreticulin-3-like [Vitis vinifera] 68 2e-09 gb|ACJ85691.1| unknown [Medicago truncatula] 68 2e-09 >ref|XP_003541149.1| PREDICTED: calreticulin-3-like [Glycine max] Length = 418 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 565 TDKLTNFYTFILRPDASYTVWSTIKKEKSGSMFTDWDILPHRTTKDL 705 TDKLT+FYTFILRPDASY++ ++ SGSM+TDWDILP R KD+ Sbjct: 170 TDKLTHFYTFILRPDASYSILVDNRERDSGSMYTDWDILPPRKIKDV 216 >ref|XP_002456774.1| hypothetical protein SORBIDRAFT_03g042500 [Sorghum bicolor] gi|241928749|gb|EES01894.1| hypothetical protein SORBIDRAFT_03g042500 [Sorghum bicolor] Length = 408 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +1 Query: 565 TDKLTNFYTFILRPDASYTVWSTIKKEKSGSMFTDWDILPHRTTKDL 705 TDKLT+FYTFILRPDASY++ ++ ++GSM+TDWDILP R KDL Sbjct: 171 TDKLTHFYTFILRPDASYSLLVDNRERETGSMYTDWDILPPRKIKDL 217 >emb|CBI17604.3| unnamed protein product [Vitis vinifera] Length = 448 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 565 TDKLTNFYTFILRPDASYTVWSTIKKEKSGSMFTDWDILPHRTTKD 702 TDKLT+FYTFILRPDASY+V ++ +SGSM++DWDILP R KD Sbjct: 194 TDKLTHFYTFILRPDASYSVLIDNRERESGSMYSDWDILPPRKIKD 239 >ref|XP_002276433.1| PREDICTED: calreticulin-3-like [Vitis vinifera] Length = 421 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 565 TDKLTNFYTFILRPDASYTVWSTIKKEKSGSMFTDWDILPHRTTKD 702 TDKLT+FYTFILRPDASY+V ++ +SGSM++DWDILP R KD Sbjct: 167 TDKLTHFYTFILRPDASYSVLIDNRERESGSMYSDWDILPPRKIKD 212 >gb|ACJ85691.1| unknown [Medicago truncatula] Length = 393 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 565 TDKLTNFYTFILRPDASYTVWSTIKKEKSGSMFTDWDILPHRTTKDL 705 TDKLT+FYTFILRPDA+Y+V ++ SGS++TDWDILP R KDL Sbjct: 171 TDKLTHFYTFILRPDATYSVLVDNRERDSGSLYTDWDILPPRKIKDL 217