BLASTX nr result
ID: Papaver22_contig00016583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016583 (1815 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167876.1| PREDICTED: serine/threonine-protein kinase H... 70 2e-09 ref|XP_004137678.1| PREDICTED: serine/threonine-protein kinase H... 70 2e-09 ref|NP_195805.2| protein kinase family protein [Arabidopsis thal... 70 2e-09 gb|AFK44948.1| unknown [Medicago truncatula] 70 2e-09 ref|XP_003557064.1| PREDICTED: serine/threonine-protein kinase H... 70 2e-09 >ref|XP_004167876.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis sativus] Length = 373 Score = 69.7 bits (169), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 720 YNNKVDVYSLDFVLWELLTN*MPFEGMTNLQAAYDAAFK 604 YNNKVDVYS VLWELLTN MPFEGM+NLQAAY AAFK Sbjct: 236 YNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFK 274 >ref|XP_004137678.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis sativus] Length = 373 Score = 69.7 bits (169), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 720 YNNKVDVYSLDFVLWELLTN*MPFEGMTNLQAAYDAAFK 604 YNNKVDVYS VLWELLTN MPFEGM+NLQAAY AAFK Sbjct: 236 YNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFK 274 >ref|NP_195805.2| protein kinase family protein [Arabidopsis thaliana] gi|22655246|gb|AAM98213.1| protein kinase ATN1-like protein [Arabidopsis thaliana] gi|25084113|gb|AAN72179.1| protein kinase ATN1-like protein [Arabidopsis thaliana] gi|332003018|gb|AED90401.1| protein kinase family protein [Arabidopsis thaliana] Length = 333 Score = 69.7 bits (169), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 720 YNNKVDVYSLDFVLWELLTN*MPFEGMTNLQAAYDAAFK 604 YNNKVDVYS VLWELLTN MPFEGM+NLQAAY AAFK Sbjct: 202 YNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFK 240 >gb|AFK44948.1| unknown [Medicago truncatula] Length = 360 Score = 69.7 bits (169), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 720 YNNKVDVYSLDFVLWELLTN*MPFEGMTNLQAAYDAAFK 604 YNNKVDVYS VLWELLTN MPFEGM+NLQAAY AAFK Sbjct: 229 YNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFK 267 >ref|XP_003557064.1| PREDICTED: serine/threonine-protein kinase HT1-like, partial [Glycine max] Length = 148 Score = 69.7 bits (169), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 720 YNNKVDVYSLDFVLWELLTN*MPFEGMTNLQAAYDAAFK 604 YNNKVDVYS VLWELLTN MPFEGM+NLQAAY AAFK Sbjct: 15 YNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFK 53