BLASTX nr result
ID: Papaver22_contig00016575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016575 (1029 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518333.1| PREDICTED: E3 ubiquitin-protein ligase liste... 81 4e-13 ref|XP_003615959.1| RING finger protein [Medicago truncatula] gi... 81 5e-13 ref|XP_004168686.1| PREDICTED: E3 ubiquitin-protein ligase liste... 80 6e-13 ref|XP_004154184.1| PREDICTED: E3 ubiquitin-protein ligase liste... 80 6e-13 ref|XP_004145301.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 80 6e-13 >ref|XP_003518333.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like [Glycine max] Length = 1885 Score = 81.3 bits (199), Expect = 4e-13 Identities = 37/73 (50%), Positives = 44/73 (60%) Frame = -2 Query: 1025 ASVEEKGPSQRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSI 846 A E G +RN KE + VEECPIC S I + P ++C TCKHKFH +C+ KWFS Sbjct: 1813 ALAEAIGIWKRNFDKEFEGVEECPICYSVIHTTNHGLPRLACKTCKHKFHSACLYKWFST 1872 Query: 845 SKNSICPLCGCKF 807 S S CPLC F Sbjct: 1873 SHKSSCPLCQSPF 1885 >ref|XP_003615959.1| RING finger protein [Medicago truncatula] gi|355517294|gb|AES98917.1| RING finger protein [Medicago truncatula] Length = 1683 Score = 80.9 bits (198), Expect = 5e-13 Identities = 37/73 (50%), Positives = 44/73 (60%) Frame = -2 Query: 1025 ASVEEKGPSQRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSI 846 A E G +RN KE + VEECPIC S I + P ++C TCKHKFH +C+ KWFS Sbjct: 1611 ALAEAIGIWKRNFDKEFEGVEECPICYSVIHTTNHGLPRLACRTCKHKFHSACLYKWFST 1670 Query: 845 SKNSICPLCGCKF 807 S S CPLC F Sbjct: 1671 SHKSSCPLCQSPF 1683 >ref|XP_004168686.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like [Cucumis sativus] Length = 120 Score = 80.5 bits (197), Expect = 6e-13 Identities = 35/64 (54%), Positives = 41/64 (64%) Frame = -2 Query: 998 QRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSISKNSICPLC 819 +RN KE + VEECPIC S I S P ++C TCKHKFH +C+ KWFS S S CPLC Sbjct: 57 KRNFDKEFEGVEECPICYSVIHTVNHSIPRLACKTCKHKFHSACLYKWFSTSHKSTCPLC 116 Query: 818 GCKF 807 F Sbjct: 117 QSPF 120 >ref|XP_004154184.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like, partial [Cucumis sativus] Length = 1660 Score = 80.5 bits (197), Expect = 6e-13 Identities = 35/64 (54%), Positives = 41/64 (64%) Frame = -2 Query: 998 QRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSISKNSICPLC 819 +RN KE + VEECPIC S I S P ++C TCKHKFH +C+ KWFS S S CPLC Sbjct: 1597 KRNFDKEFEGVEECPICYSVIHTVNHSIPRLACKTCKHKFHSACLYKWFSTSHKSTCPLC 1656 Query: 818 GCKF 807 F Sbjct: 1657 QSPF 1660 >ref|XP_004145301.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase listerin-like [Cucumis sativus] Length = 1919 Score = 80.5 bits (197), Expect = 6e-13 Identities = 35/64 (54%), Positives = 41/64 (64%) Frame = -2 Query: 998 QRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSISKNSICPLC 819 +RN KE + VEECPIC S I S P ++C TCKHKFH +C+ KWFS S S CPLC Sbjct: 1856 KRNFDKEFEGVEECPICYSVIHTVNHSIPRLACKTCKHKFHSACLYKWFSTSHKSTCPLC 1915 Query: 818 GCKF 807 F Sbjct: 1916 QSPF 1919