BLASTX nr result
ID: Papaver22_contig00016336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00016336 (757 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637736.1| Abscisic acid receptor PYL9 [Medicago trunca... 70 5e-15 gb|ACJ85952.1| unknown [Medicago truncatula] 70 5e-15 gb|AAV85853.1| AT-rich element binding factor 3 [Pisum sativum] 70 5e-15 pdb|3OQU|A Chain A, Crystal Structure Of Native Abscisic Acid Re... 68 1e-14 ref|NP_563626.1| abscisic acid receptor PYL9 [Arabidopsis thalia... 68 1e-14 >ref|XP_003637736.1| Abscisic acid receptor PYL9 [Medicago truncatula] gi|355503671|gb|AES84874.1| Abscisic acid receptor PYL9 [Medicago truncatula] gi|388519467|gb|AFK47795.1| unknown [Medicago truncatula] Length = 190 Score = 70.1 bits (170), Expect(2) = 5e-15 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 52 MRDNQCSSALVKHIKAPLHLVWSLVRRFDQPQK 150 +RDNQCSSALVKHIKAP+HLVWSLVRRFDQPQK Sbjct: 26 LRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQK 58 Score = 37.0 bits (84), Expect(2) = 5e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +2 Query: 155 GSLREVNVKSGLPATTST 208 GS+REVNVKSGLPATTST Sbjct: 75 GSVREVNVKSGLPATTST 92 >gb|ACJ85952.1| unknown [Medicago truncatula] Length = 190 Score = 70.1 bits (170), Expect(2) = 5e-15 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 52 MRDNQCSSALVKHIKAPLHLVWSLVRRFDQPQK 150 +RDNQCSSALVKHIKAP+HLVWSLVRRFDQPQK Sbjct: 26 LRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQK 58 Score = 37.0 bits (84), Expect(2) = 5e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +2 Query: 155 GSLREVNVKSGLPATTST 208 GS+REVNVKSGLPATTST Sbjct: 75 GSVREVNVKSGLPATTST 92 >gb|AAV85853.1| AT-rich element binding factor 3 [Pisum sativum] Length = 188 Score = 70.1 bits (170), Expect(2) = 5e-15 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 52 MRDNQCSSALVKHIKAPLHLVWSLVRRFDQPQK 150 +RDNQCSSALVKHIKAP+HLVWSLVRRFDQPQK Sbjct: 24 LRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQK 56 Score = 37.0 bits (84), Expect(2) = 5e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +2 Query: 155 GSLREVNVKSGLPATTST 208 GS+REVNVKSGLPATTST Sbjct: 73 GSVREVNVKSGLPATTST 90 >pdb|3OQU|A Chain A, Crystal Structure Of Native Abscisic Acid Receptor Pyl9 With Aba gi|346651932|pdb|3OQU|B Chain B, Crystal Structure Of Native Abscisic Acid Receptor Pyl9 With Aba Length = 205 Score = 67.8 bits (164), Expect(2) = 1e-14 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 55 RDNQCSSALVKHIKAPLHLVWSLVRRFDQPQK 150 R+NQC+SALVKHIKAPLHLVWSLVRRFDQPQK Sbjct: 48 RENQCTSALVKHIKAPLHLVWSLVRRFDQPQK 79 Score = 38.1 bits (87), Expect(2) = 1e-14 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +2 Query: 155 GSLREVNVKSGLPATTST 208 GSLREVNVKSGLPATTST Sbjct: 96 GSLREVNVKSGLPATTST 113 >ref|NP_563626.1| abscisic acid receptor PYL9 [Arabidopsis thaliana] gi|75147174|sp|Q84MC7.1|PYL9_ARATH RecName: Full=Abscisic acid receptor PYL9; AltName: Full=ABI1-binding protein 4; AltName: Full=PYR1-like protein 9; AltName: Full=Regulatory components of ABA receptor 1 gi|30102578|gb|AAP21207.1| At1g01360 [Arabidopsis thaliana] gi|110743456|dbj|BAE99614.1| hypothetical protein [Arabidopsis thaliana] gi|332189156|gb|AEE27277.1| abscisic acid receptor PYL9 [Arabidopsis thaliana] Length = 187 Score = 67.8 bits (164), Expect(2) = 1e-14 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 55 RDNQCSSALVKHIKAPLHLVWSLVRRFDQPQK 150 R+NQC+SALVKHIKAPLHLVWSLVRRFDQPQK Sbjct: 30 RENQCTSALVKHIKAPLHLVWSLVRRFDQPQK 61 Score = 38.1 bits (87), Expect(2) = 1e-14 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +2 Query: 155 GSLREVNVKSGLPATTST 208 GSLREVNVKSGLPATTST Sbjct: 78 GSLREVNVKSGLPATTST 95