BLASTX nr result
ID: Papaver22_contig00015374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00015374 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533427.1| ATP binding protein, putative [Ricinus commu... 56 3e-06 >ref|XP_002533427.1| ATP binding protein, putative [Ricinus communis] gi|223526727|gb|EEF28958.1| ATP binding protein, putative [Ricinus communis] Length = 661 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -3 Query: 413 IDCAAQYPDKRPTMAEVTKRIEELRPT---REQDPSSDLVEGED 291 IDCAAQYPD RP+M+EVT RIEELR + +QDP D+V+ +D Sbjct: 614 IDCAAQYPDNRPSMSEVTNRIEELRRSSIREDQDPEPDVVDLDD 657