BLASTX nr result
ID: Papaver22_contig00010516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00010516 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135883.1| PREDICTED: 26S protease regulatory subunit 7... 76 3e-12 gb|ABD61729.1| 26S proteasome ATPase subunit [Lupinus albus] 76 3e-12 gb|AAF22521.1|AF123390_1 26S proteasome AAA-ATPase subunit RPT1a... 76 3e-12 ref|NP_175778.1| regulatory particle triple-A 1A [Arabidopsis th... 76 3e-12 sp|O64982.1|PRS7_PRUPE RecName: Full=26S protease regulatory sub... 76 3e-12 >ref|XP_004135883.1| PREDICTED: 26S protease regulatory subunit 7-like [Cucumis sativus] gi|449491091|ref|XP_004158796.1| PREDICTED: 26S protease regulatory subunit 7-like [Cucumis sativus] Length = 426 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 525 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 418 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN Sbjct: 391 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 426 >gb|ABD61729.1| 26S proteasome ATPase subunit [Lupinus albus] Length = 185 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 525 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 418 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN Sbjct: 150 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 185 >gb|AAF22521.1|AF123390_1 26S proteasome AAA-ATPase subunit RPT1a [Arabidopsis thaliana] Length = 426 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 525 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 418 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN Sbjct: 391 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 426 >ref|NP_175778.1| regulatory particle triple-A 1A [Arabidopsis thaliana] gi|297853156|ref|XP_002894459.1| regulatory particle triple-a 1A [Arabidopsis lyrata subsp. lyrata] gi|28558169|sp|Q9SSB5.1|PRS7A_ARATH RecName: Full=26S protease regulatory subunit 7 homolog A; AltName: Full=26S proteasome AAA-ATPase subunit RPT1a; AltName: Full=26S proteasome subunit 7 homolog A; AltName: Full=Regulatory particle triple-A ATPase subunit 1a gi|6056388|gb|AAF02852.1|AC009324_1 26S proteasome ATPase subunit [Arabidopsis thaliana] gi|12324021|gb|AAG51970.1|AC024260_8 26S proteasome ATPase subunit; 3861-6264 [Arabidopsis thaliana] gi|17065568|gb|AAL32938.1| 26S proteasome ATPase subunit [Arabidopsis thaliana] gi|23197722|gb|AAN15388.1| 26S proteasome ATPase subunit [Arabidopsis thaliana] gi|297340301|gb|EFH70718.1| regulatory particle triple-a 1A [Arabidopsis lyrata subsp. lyrata] gi|332194871|gb|AEE32992.1| regulatory particle triple-A 1A [Arabidopsis thaliana] Length = 426 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 525 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 418 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN Sbjct: 391 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 426 >sp|O64982.1|PRS7_PRUPE RecName: Full=26S protease regulatory subunit 7; AltName: Full=26S proteasome AAA-ATPase subunit RPT1; AltName: Full=26S proteasome subunit 7; AltName: Full=Regulatory particle triple-A ATPase subunit 1 gi|3172331|gb|AAC18523.1| 26S proteasome subunit 7 [Prunus persica] Length = 425 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 525 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 418 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN Sbjct: 390 RARRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN 425