BLASTX nr result
ID: Papaver22_contig00009087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00009087 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADM72799.1| callose synthase 3 [Arabidopsis thaliana] 164 7e-39 ref|NP_001154712.2| callose synthase [Arabidopsis thaliana] gi|3... 164 7e-39 ref|NP_196804.6| callose synthase [Arabidopsis thaliana] gi|3575... 164 7e-39 ref|XP_002528124.1| transferase, transferring glycosyl groups, p... 161 6e-38 ref|XP_002304888.1| predicted protein [Populus trichocarpa] gi|2... 161 6e-38 >gb|ADM72799.1| callose synthase 3 [Arabidopsis thaliana] Length = 1947 Score = 164 bits (415), Expect = 7e-39 Identities = 79/83 (95%), Positives = 82/83 (98%) Frame = +3 Query: 3 LIAQACKPVVHKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 182 LIAQACKPVVH+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF Sbjct: 1865 LIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 1924 Query: 183 SRGLQISRILGGQRKERSSRNKE 251 SRGLQISRILGG RK+RSSRNKE Sbjct: 1925 SRGLQISRILGGHRKDRSSRNKE 1947 >ref|NP_001154712.2| callose synthase [Arabidopsis thaliana] gi|332004457|gb|AED91840.1| callose synthase [Arabidopsis thaliana] Length = 1914 Score = 164 bits (415), Expect = 7e-39 Identities = 79/83 (95%), Positives = 82/83 (98%) Frame = +3 Query: 3 LIAQACKPVVHKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 182 LIAQACKPVVH+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF Sbjct: 1832 LIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 1891 Query: 183 SRGLQISRILGGQRKERSSRNKE 251 SRGLQISRILGG RK+RSSRNKE Sbjct: 1892 SRGLQISRILGGHRKDRSSRNKE 1914 >ref|NP_196804.6| callose synthase [Arabidopsis thaliana] gi|357529555|sp|Q9LXT9.3|CALS3_ARATH RecName: Full=Callose synthase 3; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 12 gi|332004456|gb|AED91839.1| callose synthase [Arabidopsis thaliana] Length = 1955 Score = 164 bits (415), Expect = 7e-39 Identities = 79/83 (95%), Positives = 82/83 (98%) Frame = +3 Query: 3 LIAQACKPVVHKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 182 LIAQACKPVVH+AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF Sbjct: 1873 LIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 1932 Query: 183 SRGLQISRILGGQRKERSSRNKE 251 SRGLQISRILGG RK+RSSRNKE Sbjct: 1933 SRGLQISRILGGHRKDRSSRNKE 1955 >ref|XP_002528124.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223532463|gb|EEF34254.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1974 Score = 161 bits (407), Expect = 6e-38 Identities = 77/83 (92%), Positives = 82/83 (98%) Frame = +3 Query: 3 LIAQACKPVVHKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 182 LIAQACKP+VH+ GFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF Sbjct: 1873 LIAQACKPLVHRMGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 1932 Query: 183 SRGLQISRILGGQRKERSSRNKE 251 SRGLQISRILGGQRK+RSSR+KE Sbjct: 1933 SRGLQISRILGGQRKDRSSRSKE 1955 >ref|XP_002304888.1| predicted protein [Populus trichocarpa] gi|222842320|gb|EEE79867.1| predicted protein [Populus trichocarpa] Length = 1961 Score = 161 bits (407), Expect = 6e-38 Identities = 78/83 (93%), Positives = 81/83 (97%) Frame = +3 Query: 3 LIAQACKPVVHKAGFWGSVRTLARGYEIIMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 182 LIAQACKPVV +AGFWGSVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF Sbjct: 1879 LIAQACKPVVQRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAF 1938 Query: 183 SRGLQISRILGGQRKERSSRNKE 251 SRGLQISRILGG RK+RSSRNKE Sbjct: 1939 SRGLQISRILGGHRKDRSSRNKE 1961