BLASTX nr result
ID: Papaver22_contig00007671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00007671 (866 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550028.1| PREDICTED: probable hexaprenyl pyrophosphate... 59 1e-06 ref|XP_003525839.1| PREDICTED: probable hexaprenyl pyrophosphate... 59 1e-06 gb|AFK35985.1| unknown [Lotus japonicus] 58 3e-06 gb|AEM42978.1| geranyl diphosphate synthase [Siraitia grosvenorii] 57 5e-06 gb|ACC77966.1| geranyl pyrophosphate synthase [Catharanthus roseus] 57 5e-06 >ref|XP_003550028.1| PREDICTED: probable hexaprenyl pyrophosphate synthase, mitochondrial-like [Glycine max] Length = 419 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 121 GIVMAPILFAIEEFP*LRKIVERGFHNPADVDLATKILGK 2 GIV APILFA+EEFP LR IV+ GF NPA+VDLA + LGK Sbjct: 328 GIVTAPILFAMEEFPQLRAIVDEGFENPANVDLALEYLGK 367 >ref|XP_003525839.1| PREDICTED: probable hexaprenyl pyrophosphate synthase, mitochondrial-like [Glycine max] Length = 480 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 121 GIVMAPILFAIEEFP*LRKIVERGFHNPADVDLATKILGK 2 GIV APILFA+EEFP LR IV+ GF NPA+VDLA + LGK Sbjct: 389 GIVTAPILFAMEEFPQLRTIVDEGFENPANVDLALEYLGK 428 >gb|AFK35985.1| unknown [Lotus japonicus] Length = 132 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 121 GIVMAPILFAIEEFP*LRKIVERGFHNPADVDLATKILGK 2 GIV APILFA+EEFP LR IVE GF NP +VDLA + LGK Sbjct: 41 GIVTAPILFAMEEFPQLRAIVEDGFENPENVDLALEYLGK 80 >gb|AEM42978.1| geranyl diphosphate synthase [Siraitia grosvenorii] Length = 423 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 121 GIVMAPILFAIEEFP*LRKIVERGFHNPADVDLATKILGK 2 GI+ AP+LFA+EEFP LR +VERGF NP ++D+A LGK Sbjct: 332 GIITAPLLFAMEEFPQLRTVVERGFDNPENIDIAMDFLGK 371 >gb|ACC77966.1| geranyl pyrophosphate synthase [Catharanthus roseus] Length = 420 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -2 Query: 121 GIVMAPILFAIEEFP*LRKIVERGFHNPADVDLATKILGK 2 GIV APILFAIEEFP LR +V+ GF NP +VDLA LGK Sbjct: 329 GIVTAPILFAIEEFPELRAVVDEGFENPYNVDLALHYLGK 368