BLASTX nr result
ID: Papaver22_contig00007030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00007030 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523300.1| PREDICTED: uncharacterized protein LOC100820... 69 6e-10 gb|ABF06706.1| UP-9A [Nicotiana tabacum] 68 1e-09 ref|XP_002269666.2| PREDICTED: uncharacterized protein LOC100267... 66 4e-09 ref|XP_003526781.1| PREDICTED: uncharacterized protein LOC100813... 66 4e-09 ref|XP_003602442.1| hypothetical protein MTR_3g093400 [Medicago ... 64 2e-08 >ref|XP_003523300.1| PREDICTED: uncharacterized protein LOC100820369 [Glycine max] Length = 121 Score = 68.9 bits (167), Expect = 6e-10 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = -3 Query: 518 QRLYVVEEAEERLCSQLGELEAEALDHVRLYQAQIRSLHEQLSQAQTLLQSINSSS 351 +RL V EEAEERLCSQLGELEAEA+ H R Y A+I SL +QLS+AQ+LL +SS Sbjct: 59 ERLRVAEEAEERLCSQLGELEAEAVYHARDYHARIVSLMDQLSRAQSLLLKTGASS 114 >gb|ABF06706.1| UP-9A [Nicotiana tabacum] Length = 117 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = -3 Query: 524 TTQRLYVVEEAEERLCSQLGELEAEALDHVRLYQAQIRSLHEQLSQAQTLLQSINSSSPN 345 T +RL V EEAEERLCSQLGELEAEA+D R Y+ ++ L +QLS AQ LL+S + + P+ Sbjct: 56 TWERLRVAEEAEERLCSQLGELEAEAVDQARTYRTRVIHLMDQLSLAQKLLESASITVPS 115 >ref|XP_002269666.2| PREDICTED: uncharacterized protein LOC100267499 [Vitis vinifera] Length = 116 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/58 (62%), Positives = 41/58 (70%) Frame = -3 Query: 518 QRLYVVEEAEERLCSQLGELEAEALDHVRLYQAQIRSLHEQLSQAQTLLQSINSSSPN 345 +RL V EEAEERLCSQLGELEAEA+D R Y +I SL QLSQA L+Q + PN Sbjct: 59 ERLRVAEEAEERLCSQLGELEAEAVDQARQYNNRIVSLMNQLSQAHRLIQPGPTPVPN 116 >ref|XP_003526781.1| PREDICTED: uncharacterized protein LOC100813653 [Glycine max] Length = 120 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -3 Query: 518 QRLYVVEEAEERLCSQLGELEAEALDHVRLYQAQIRSLHEQLSQAQTLLQSINSSS 351 +RL V EEAEERLCSQLGELEAEA+ R Y A+I SL +QLS+AQ+LL ++SS Sbjct: 58 ERLRVAEEAEERLCSQLGELEAEAVYQARDYHARIVSLMDQLSRAQSLLLKTSASS 113 >ref|XP_003602442.1| hypothetical protein MTR_3g093400 [Medicago truncatula] gi|355491490|gb|AES72693.1| hypothetical protein MTR_3g093400 [Medicago truncatula] gi|388522453|gb|AFK49288.1| unknown [Medicago truncatula] Length = 118 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = -3 Query: 518 QRLYVVEEAEERLCSQLGELEAEALDHVRLYQAQIRSLHEQLSQAQTLLQSINSSS 351 +RL V EEAEERLCSQLGELEAEA+ R Y +I SL +QLS+AQ+LL +S+S Sbjct: 61 ERLRVAEEAEERLCSQLGELEAEAVYQARDYHDRIVSLMDQLSRAQSLLHIASSNS 116