BLASTX nr result
ID: Papaver22_contig00004744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00004744 (750 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624316.1| Transcription factor [Medicago truncatula] g... 86 1e-14 ref|XP_002511578.1| RNA binding protein, putative [Ricinus commu... 83 5e-14 dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium prat... 80 5e-13 dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium prat... 80 5e-13 ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-bindin... 80 5e-13 >ref|XP_003624316.1| Transcription factor [Medicago truncatula] gi|355499331|gb|AES80534.1| Transcription factor [Medicago truncatula] Length = 625 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = -1 Query: 156 PRRVFERHSGTGHGNDFKREGSGRGNWGTAGDEIARDTEQ-PNENEKNLGAEK 1 PRR FERHSGTG GNDFKREG+GRGNWGT DEIA+ TE+ NE EKNLG EK Sbjct: 167 PRRTFERHSGTGRGNDFKREGAGRGNWGTETDEIAQVTEEVMNEGEKNLGDEK 219 >ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis] gi|223548758|gb|EEF50247.1| RNA binding protein, putative [Ricinus communis] Length = 295 Score = 83.2 bits (204), Expect = 5e-14 Identities = 39/53 (73%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = -1 Query: 156 PRRVFERHSGTGHGNDFKREGSGRGNWGTAGDEIARDTEQP-NENEKNLGAEK 1 PRR FER SGTGHGN+FKREG+GRGNWGT DEIA+ TE+ NE EKN+G EK Sbjct: 157 PRRAFERRSGTGHGNEFKREGAGRGNWGTNTDEIAQVTEEAVNEGEKNMGDEK 209 >dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense] Length = 371 Score = 80.1 bits (196), Expect = 5e-13 Identities = 38/53 (71%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 156 PRRVFERHSGTGHGNDFKREGSGRGNWGTAGDEIARDTEQP-NENEKNLGAEK 1 PRR FERHSGTG GN+FKREG+GRGNWGT DEIA+ TE+ E EKN+G EK Sbjct: 161 PRRTFERHSGTGRGNEFKREGAGRGNWGTETDEIAQVTEEAVIEGEKNIGDEK 213 >dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense] Length = 371 Score = 80.1 bits (196), Expect = 5e-13 Identities = 38/53 (71%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 156 PRRVFERHSGTGHGNDFKREGSGRGNWGTAGDEIARDTEQP-NENEKNLGAEK 1 PRR FERHSGTG GN+FKREG+GRGNWGT DEIA+ TE+ E EKN+G EK Sbjct: 161 PRRTFERHSGTGRGNEFKREGAGRGNWGTETDEIAQVTEEAVIEGEKNIGDEK 213 >ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative [Ricinus communis] gi|223528571|gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative [Ricinus communis] Length = 364 Score = 80.1 bits (196), Expect = 5e-13 Identities = 36/53 (67%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = -1 Query: 156 PRRVFERHSGTGHGNDFKREGSGRGNWGTAGDEIARDTEQP-NENEKNLGAEK 1 PRR+++R SGTG GN+FKREG+GRGNWGT DEIA + E+P ENEKN+G EK Sbjct: 156 PRRLYDRRSGTGRGNEFKREGAGRGNWGTPADEIAPEIEEPLIENEKNIGIEK 208