BLASTX nr result
ID: Papaver22_contig00004093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00004093 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298397.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 gb|ABK25823.1| unknown [Picea sitchensis] 78 9e-13 gb|ABK23357.1| unknown [Picea sitchensis] 77 1e-12 gb|ABK21813.1| unknown [Picea sitchensis] gi|224284774|gb|ACN401... 77 1e-12 emb|CAC27136.1| 40S ribosomal protein S2 [Picea abies] 77 1e-12 >ref|XP_002298397.1| predicted protein [Populus trichocarpa] gi|222845655|gb|EEE83202.1| predicted protein [Populus trichocarpa] Length = 270 Score = 78.2 bits (191), Expect = 7e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +3 Query: 3 LQKTYGFLTPDFWKETRFTKSPFQEYTDLLAKPTKAITLEEVE 131 L KTYGFLTPDFW ETRF KSPFQE+TDLLAKPTK + LE+VE Sbjct: 224 LLKTYGFLTPDFWTETRFIKSPFQEFTDLLAKPTKTLVLEDVE 266 >gb|ABK25823.1| unknown [Picea sitchensis] Length = 280 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LQKTYGFLTPDFWKETRFTKSPFQEYTDLLAKPTKAITLEEVE 131 L KTYGFLTPD W+ETRF+KSPFQEYTDLLAKP KA+ LE+V+ Sbjct: 233 LLKTYGFLTPDLWRETRFSKSPFQEYTDLLAKPAKALVLEDVD 275 >gb|ABK23357.1| unknown [Picea sitchensis] Length = 232 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LQKTYGFLTPDFWKETRFTKSPFQEYTDLLAKPTKAITLEEVE 131 L KTYGFLTPD W+ETRF+KSPFQEYTDLLAKP KA+ LE+V+ Sbjct: 185 LLKTYGFLTPDLWRETRFSKSPFQEYTDLLAKPAKALILEDVD 227 >gb|ABK21813.1| unknown [Picea sitchensis] gi|224284774|gb|ACN40117.1| unknown [Picea sitchensis] Length = 270 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LQKTYGFLTPDFWKETRFTKSPFQEYTDLLAKPTKAITLEEVE 131 L KTYGFLTPD W+ETRF+KSPFQEYTDLLAKP KA+ LE+V+ Sbjct: 223 LLKTYGFLTPDLWRETRFSKSPFQEYTDLLAKPAKALILEDVD 265 >emb|CAC27136.1| 40S ribosomal protein S2 [Picea abies] Length = 232 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 LQKTYGFLTPDFWKETRFTKSPFQEYTDLLAKPTKAITLEEVE 131 L KTYGFLTPD W+ETRF+KSPFQEYTDLLAKP KA+ LE+V+ Sbjct: 185 LLKTYGFLTPDLWRETRFSKSPFQEYTDLLAKPAKALILEDVD 227