BLASTX nr result
ID: Papaver22_contig00003884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00003884 (825 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594199.1| hypothetical protein MTR_2g025520 [Medicago ... 118 1e-24 ref|XP_003534730.1| PREDICTED: uncharacterized protein LOC100811... 117 3e-24 ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago ... 117 4e-24 ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago ... 117 4e-24 ref|XP_003547277.1| PREDICTED: uncharacterized protein LOC100807... 115 1e-23 >ref|XP_003594199.1| hypothetical protein MTR_2g025520 [Medicago truncatula] gi|124359329|gb|ABN05810.1| Protein of unknown function DUF506, plant [Medicago truncatula] gi|355483247|gb|AES64450.1| hypothetical protein MTR_2g025520 [Medicago truncatula] Length = 321 Score = 118 bits (296), Expect = 1e-24 Identities = 60/109 (55%), Positives = 77/109 (70%), Gaps = 5/109 (4%) Frame = +2 Query: 5 IARPTNCYNSLLEVFPQVFVGKPDKLKQVVRIMCGASKQSLKKNDMHIPPWRSNGYMQAK 184 IARPTN Y+SLL +FP++FVGK ++LK++VR+MC A K S+KK D+HIPPWR N YMQ K Sbjct: 191 IARPTNQYSSLLNIFPKIFVGKMEELKRIVRLMCSAIKGSMKKMDLHIPPWRRNLYMQTK 250 Query: 185 WLSLYKRTTNSVEDMVVSS-----SGAGKRSVGFETTPTPVKFYYCREE 316 W S YKRTTN+V + SS S K+ +GFE VK Y CR++ Sbjct: 251 WFSSYKRTTNAVATIKASSHFSVESFCPKKFMGFEA--RHVKAYNCRDD 297 >ref|XP_003534730.1| PREDICTED: uncharacterized protein LOC100811764 [Glycine max] Length = 281 Score = 117 bits (293), Expect = 3e-24 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 6/121 (4%) Frame = +2 Query: 5 IARPTNCYNSLLEVFPQVFVGKPDKLKQVVRIMCGASKQSLKKNDMHIPPWRSNGYMQAK 184 IARPT+ Y+SLL+VFP +FVGK +++KQVVR+MC A K S+K+ +HIPPWR N YMQAK Sbjct: 151 IARPTDQYSSLLDVFPLIFVGKVEEMKQVVRLMCTAIKGSMKRMKLHIPPWRRNVYMQAK 210 Query: 185 WLSLYKRTTNSVEDMVVS------SSGAGKRSVGFETTPTPVKFYYCREELERRRDARMG 346 W YKRTTN+V VS S KRS+GFE PVK + CR+ R G Sbjct: 211 WFGAYKRTTNAVATKRVSLPLSSDESLFPKRSIGFEV--RPVKAHKCRDVYATNTGFRTG 268 Query: 347 Y 349 + Sbjct: 269 H 269 >ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago truncatula] gi|355511563|gb|AES92705.1| hypothetical protein MTR_4g132970 [Medicago truncatula] Length = 305 Score = 117 bits (292), Expect = 4e-24 Identities = 59/103 (57%), Positives = 71/103 (68%) Frame = +2 Query: 5 IARPTNCYNSLLEVFPQVFVGKPDKLKQVVRIMCGASKQSLKKNDMHIPPWRSNGYMQAK 184 IARPTN Y SLL+VFP VFVGK ++LK+VVRIMC A K S+K DMH+PPWR N YMQAK Sbjct: 193 IARPTNQYTSLLDVFPLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAK 252 Query: 185 WLSLYKRTTNSVEDMVVSSSGAGKRSVGFETTPTPVKFYYCRE 313 W + YKRTTN V A +S+ FE P+K Y C++ Sbjct: 253 WFNTYKRTTNEV---------ATNKSITFEA--RPLKAYNCKD 284 >ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago truncatula] gi|355511560|gb|AES92702.1| hypothetical protein MTR_4g132940 [Medicago truncatula] Length = 287 Score = 117 bits (292), Expect = 4e-24 Identities = 59/103 (57%), Positives = 71/103 (68%) Frame = +2 Query: 5 IARPTNCYNSLLEVFPQVFVGKPDKLKQVVRIMCGASKQSLKKNDMHIPPWRSNGYMQAK 184 IARPTN Y SLL+VFP VFVGK ++LK+VVRIMC A K S+K DMH+PPWR N YMQAK Sbjct: 175 IARPTNQYTSLLDVFPLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAK 234 Query: 185 WLSLYKRTTNSVEDMVVSSSGAGKRSVGFETTPTPVKFYYCRE 313 W + YKRTTN V A +S+ FE P+K Y C++ Sbjct: 235 WFNTYKRTTNEV---------ATNKSITFEA--RPLKAYNCKD 266 >ref|XP_003547277.1| PREDICTED: uncharacterized protein LOC100807096 [Glycine max] Length = 312 Score = 115 bits (288), Expect = 1e-23 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 6/121 (4%) Frame = +2 Query: 5 IARPTNCYNSLLEVFPQVFVGKPDKLKQVVRIMCGASKQSLKKNDMHIPPWRSNGYMQAK 184 IARPT+ Y+SLL+VFP +FVGK +++KQV R+MC A K S+K+ ++HIPPWR N YMQAK Sbjct: 182 IARPTDQYSSLLDVFPLIFVGKVEEMKQVARLMCTALKGSMKRMNLHIPPWRRNMYMQAK 241 Query: 185 WLSLYKRTTNSVEDMVVS------SSGAGKRSVGFETTPTPVKFYYCREELERRRDARMG 346 W S YKRTTN+V S S KRS+GFE PVK + CR+ R+G Sbjct: 242 WFSAYKRTTNAVATKRASLPLSSDESLFPKRSMGFEV--RPVKAHNCRDVYATITGFRIG 299 Query: 347 Y 349 + Sbjct: 300 H 300