BLASTX nr result
ID: Papaver22_contig00002588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00002588 (514 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317586.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 dbj|BAE45851.1| DNA polymerase [Nicotiana tabacum] 58 7e-07 dbj|BAE45850.1| DNA polymerase [Nicotiana tabacum] 58 7e-07 gb|AAG50942.1|AC079284_17 DNA polymerase A family protein, putat... 58 9e-07 ref|NP_175498.2| polymerase gamma 2 [Arabidopsis thaliana] gi|33... 58 9e-07 >ref|XP_002317586.1| predicted protein [Populus trichocarpa] gi|222860651|gb|EEE98198.1| predicted protein [Populus trichocarpa] Length = 834 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 VNCMSKPFDGKNFLKVDLSVDAKVAKNWYAAK 96 V+CMSKPF GKNFLKVDL+VDAK A+NWY+AK Sbjct: 803 VDCMSKPFGGKNFLKVDLAVDAKCAQNWYSAK 834 >dbj|BAE45851.1| DNA polymerase [Nicotiana tabacum] Length = 1152 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 VNCMSKPFDGKNFLKVDLSVDAKVAKNWYAAK 96 V+CMSKPF GKN L+VDLSVD+K AKNWY+AK Sbjct: 1121 VDCMSKPFGGKNILRVDLSVDSKCAKNWYSAK 1152 >dbj|BAE45850.1| DNA polymerase [Nicotiana tabacum] Length = 1152 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 VNCMSKPFDGKNFLKVDLSVDAKVAKNWYAAK 96 V+CMSKPF GKN L+VDLSVD+K AKNWY+AK Sbjct: 1121 VDCMSKPFGGKNILRVDLSVDSKCAKNWYSAK 1152 >gb|AAG50942.1|AC079284_17 DNA polymerase A family protein, putative [Arabidopsis thaliana] Length = 1067 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 VNCMSKPFDGKNFLKVDLSVDAKVAKNWYAAK 96 V+CMSKPF+G+N L VDLSVDAK A+NWYAAK Sbjct: 1036 VDCMSKPFNGRNILSVDLSVDAKCAQNWYAAK 1067 >ref|NP_175498.2| polymerase gamma 2 [Arabidopsis thaliana] gi|332194474|gb|AEE32595.1| polymerase gamma 2 [Arabidopsis thaliana] Length = 1050 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 VNCMSKPFDGKNFLKVDLSVDAKVAKNWYAAK 96 V+CMSKPF+G+N L VDLSVDAK A+NWYAAK Sbjct: 1019 VDCMSKPFNGRNILSVDLSVDAKCAQNWYAAK 1050