BLASTX nr result
ID: Papaver22_contig00001987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver22_contig00001987 (784 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521418.1| nucleic acid binding protein, putative [Rici... 64 5e-08 ref|XP_002317234.1| predicted protein [Populus trichocarpa] gi|2... 59 9e-07 ref|XP_002305007.1| predicted protein [Populus trichocarpa] gi|2... 59 9e-07 gb|ADB96021.1| putative nucleic acid binding protein [Freesia re... 59 2e-06 ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arab... 58 3e-06 >ref|XP_002521418.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539317|gb|EEF40908.1| nucleic acid binding protein, putative [Ricinus communis] Length = 147 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = +3 Query: 354 IRPTVVCKEKGPCYKKKLRCPAKCFTXXXXXXXXXXXXXXXXXCTMD 494 IRPTVVCKEKGPCYKKKL CPAKCFT CTMD Sbjct: 92 IRPTVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTMD 138 >ref|XP_002317234.1| predicted protein [Populus trichocarpa] gi|222860299|gb|EEE97846.1| predicted protein [Populus trichocarpa] Length = 142 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = +3 Query: 354 IRPTVVCKEKGPCYKKKLRCPAKCFTXXXXXXXXXXXXXXXXXCTMD 494 I+P+VVCKEKGPCYKKKL CPAKCFT CT+D Sbjct: 87 IKPSVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTID 133 >ref|XP_002305007.1| predicted protein [Populus trichocarpa] gi|222847971|gb|EEE85518.1| predicted protein [Populus trichocarpa] Length = 148 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = +3 Query: 354 IRPTVVCKEKGPCYKKKLRCPAKCFTXXXXXXXXXXXXXXXXXCTMD 494 +RP+VVCKE+GPCYKKKL CPAKCFT CT+D Sbjct: 94 VRPSVVCKERGPCYKKKLTCPAKCFTSHSRSGKGYGGGGGGGGCTLD 140 >gb|ADB96021.1| putative nucleic acid binding protein [Freesia refracta] Length = 137 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = +3 Query: 354 IRPTVVCKEKGPCYKKKLRCPAKCFTXXXXXXXXXXXXXXXXXCTMD 494 IRP+ VC EKGPCYKKKL CPAKCFT CTMD Sbjct: 83 IRPSTVCSEKGPCYKKKLTCPAKCFTSYNRSGRNYGSGGGGGGCTMD 129 >ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] gi|297315712|gb|EFH46135.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] Length = 131 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = +3 Query: 354 IRPTVVCKEKGPCYKKKLRCPAKCFTXXXXXXXXXXXXXXXXXCTMD 494 +RPTV C+EKGPCY KKLRCPAKCF CTMD Sbjct: 76 VRPTVTCREKGPCYGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMD 122