BLASTX nr result
ID: Panax25_contig00036704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036704 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP06690.1 unnamed protein product [Coffea canephora] 62 1e-08 GAU26731.1 hypothetical protein TSUD_317290 [Trifolium subterran... 60 3e-08 XP_020114267.1 zinc finger CCCH domain-containing protein 11 [An... 60 4e-08 KZV53655.1 zinc finger protein [Dorcoceras hygrometricum] 60 4e-08 KZN00520.1 hypothetical protein DCAR_009274 [Daucus carota subsp... 60 5e-08 XP_017238516.1 PREDICTED: zinc finger CCCH domain-containing pro... 60 5e-08 XP_011077389.1 PREDICTED: zinc finger CCCH domain-containing pro... 60 5e-08 OAY84806.1 Zinc finger CCCH domain-containing protein 11 [Ananas... 60 5e-08 XP_019443036.1 PREDICTED: zinc finger CCCH domain-containing pro... 59 7e-08 XP_013664469.1 PREDICTED: zinc finger CCCH domain-containing pro... 58 7e-08 XP_004497453.1 PREDICTED: zinc finger CCCH domain-containing pro... 59 1e-07 XP_002312050.1 hypothetical protein POPTR_0008s04540g [Populus t... 59 1e-07 XP_011004143.1 PREDICTED: zinc finger CCCH domain-containing pro... 59 1e-07 XP_006388158.1 zinc finger family protein [Populus trichocarpa] ... 59 1e-07 XP_006373858.1 zinc finger family protein [Populus trichocarpa] ... 59 1e-07 XP_011004142.1 PREDICTED: zinc finger CCCH domain-containing pro... 59 1e-07 ONI24040.1 hypothetical protein PRUPE_2G220500 [Prunus persica] 58 2e-07 XP_003520639.1 PREDICTED: zinc finger CCCH domain-containing pro... 58 3e-07 XP_019462310.1 PREDICTED: zinc finger CCCH domain-containing pro... 58 3e-07 XP_019428598.1 PREDICTED: zinc finger CCCH domain-containing pro... 58 3e-07 >CDP06690.1 unnamed protein product [Coffea canephora] Length = 369 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 25 GKEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 GKE++ M+DWD ETLEKVVESK NEYN+NKPTDI Sbjct: 133 GKEQDTMDDWDQETLEKVVESKSNEYNKNKPTDI 166 >GAU26731.1 hypothetical protein TSUD_317290 [Trifolium subterraneum] Length = 306 Score = 60.1 bits (144), Expect = 3e-08 Identities = 35/65 (53%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDIGSLKFSVIFICDLIHLKYYIGF-QNPK 204 ++ E ME+WD ETLEKVVESK NEYNQNKPTDI F D + K Y F Q P Sbjct: 128 RDDETMEEWDQETLEKVVESKKNEYNQNKPTDIVCKHF-----LDAVERKQYGWFWQCPN 182 Query: 205 GIRFC 219 G + C Sbjct: 183 GGKNC 187 >XP_020114267.1 zinc finger CCCH domain-containing protein 11 [Ananas comosus] OAY69198.1 Zinc finger CCCH domain-containing protein 11 [Ananas comosus] Length = 367 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +++E MEDWD ETLEKVVESK NEYNQNKPTDI Sbjct: 131 RDQETMEDWDQETLEKVVESKKNEYNQNKPTDI 163 >KZV53655.1 zinc finger protein [Dorcoceras hygrometricum] Length = 375 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 31 EKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +KE MEDWD ETLEKVVESK NEYN+NKPTDI Sbjct: 135 DKETMEDWDQETLEKVVESKSNEYNKNKPTDI 166 >KZN00520.1 hypothetical protein DCAR_009274 [Daucus carota subsp. sativus] Length = 324 Score = 59.7 bits (143), Expect = 5e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++++ MEDWD ETLEKVVESKG EYNQNKPTDI Sbjct: 130 RDEDTMEDWDQETLEKVVESKGKEYNQNKPTDI 162 >XP_017238516.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like [Daucus carota subsp. sativus] Length = 362 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 34 KEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 K+ MEDWD ETLEKVVESKG EYNQNKPTDI Sbjct: 134 KDTMEDWDQETLEKVVESKGKEYNQNKPTDI 164 >XP_011077389.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like [Sesamum indicum] Length = 363 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 KE+E MEDWD ETLEKVV SK NEYN+NKPTDI Sbjct: 134 KERETMEDWDQETLEKVVASKSNEYNKNKPTDI 166 >OAY84806.1 Zinc finger CCCH domain-containing protein 11 [Ananas comosus] Length = 364 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 31 EKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +K+ MEDWD ETLEKVVESK NEYNQNKPTDI Sbjct: 129 DKQTMEDWDQETLEKVVESKKNEYNQNKPTDI 160 >XP_019443036.1 PREDICTED: zinc finger CCCH domain-containing protein 21-like [Lupinus angustifolius] XP_019443038.1 PREDICTED: zinc finger CCCH domain-containing protein 21-like [Lupinus angustifolius] OIW12214.1 hypothetical protein TanjilG_28622 [Lupinus angustifolius] Length = 358 Score = 59.3 bits (142), Expect = 7e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++ E MEDWD ETLEKVVESK NEYNQNKPTDI Sbjct: 129 RDDETMEDWDQETLEKVVESKKNEYNQNKPTDI 161 >XP_013664469.1 PREDICTED: zinc finger CCCH domain-containing protein 21-like [Brassica napus] XP_013664470.1 PREDICTED: zinc finger CCCH domain-containing protein 21-like [Brassica napus] Length = 175 Score = 57.8 bits (138), Expect = 7e-08 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 31 EKEPMEDWD*ETLEKVVESKGNEYNQNKPTDIGS-LKFSVIFI 156 E ME+WD ETLEKVVESK NEYNQNKPTDI S FS++++ Sbjct: 132 EDGDMEEWDQETLEKVVESKKNEYNQNKPTDIVSPYSFSLLYL 174 >XP_004497453.1 PREDICTED: zinc finger CCCH domain-containing protein 21 [Cicer arietinum] Length = 362 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++++ MEDWD ETLEKVVESK NEYNQNKPTDI Sbjct: 129 RDEDTMEDWDQETLEKVVESKKNEYNQNKPTDI 161 >XP_002312050.1 hypothetical protein POPTR_0008s04540g [Populus trichocarpa] EEE89417.1 hypothetical protein POPTR_0008s04540g [Populus trichocarpa] Length = 363 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++++ MEDWD ETLEKVVESK NEYNQNKPTDI Sbjct: 129 RDEDTMEDWDQETLEKVVESKKNEYNQNKPTDI 161 >XP_011004143.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like isoform X2 [Populus euphratica] Length = 359 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +++E MEDWD ETLEKVVESKG EY QNKPTDI Sbjct: 130 RDQETMEDWDQETLEKVVESKGKEYQQNKPTDI 162 >XP_006388158.1 zinc finger family protein [Populus trichocarpa] ERP47072.1 zinc finger family protein [Populus trichocarpa] Length = 359 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +++E MEDWD ETLEKVVESKG EY QNKPTDI Sbjct: 130 RDQETMEDWDQETLEKVVESKGKEYQQNKPTDI 162 >XP_006373858.1 zinc finger family protein [Populus trichocarpa] ERP51655.1 zinc finger family protein [Populus trichocarpa] Length = 360 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +++E MEDWD ETLEKVVESKG EY QNKPTDI Sbjct: 130 RDQETMEDWDQETLEKVVESKGKEYQQNKPTDI 162 >XP_011004142.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like isoform X1 [Populus euphratica] Length = 365 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +++E MEDWD ETLEKVVESKG EY QNKPTDI Sbjct: 130 RDQETMEDWDQETLEKVVESKGKEYQQNKPTDI 162 >ONI24040.1 hypothetical protein PRUPE_2G220500 [Prunus persica] Length = 296 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++ E MEDWD ETLEKVVESK NEYNQNKPT+I Sbjct: 62 RDDETMEDWDQETLEKVVESKKNEYNQNKPTEI 94 >XP_003520639.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like [Glycine max] KHN09466.1 Zinc finger CCCH domain-containing protein 11 [Glycine soja] KRH67630.1 hypothetical protein GLYMA_03G177100 [Glycine max] Length = 356 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 +++E MEDWD ETLEKVVESK EYNQNKPTDI Sbjct: 130 RDEETMEDWDQETLEKVVESKKTEYNQNKPTDI 162 >XP_019462310.1 PREDICTED: zinc finger CCCH domain-containing protein 21-like [Lupinus angustifolius] OIW01635.1 hypothetical protein TanjilG_14634 [Lupinus angustifolius] Length = 357 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++ E ME+WD ETLEKVVESK NEYNQNKPTDI Sbjct: 129 RDDETMEEWDQETLEKVVESKKNEYNQNKPTDI 161 >XP_019428598.1 PREDICTED: zinc finger CCCH domain-containing protein 21-like [Lupinus angustifolius] Length = 358 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 28 KEKEPMEDWD*ETLEKVVESKGNEYNQNKPTDI 126 ++ E ME+WD ETLEKVVESK NEYNQNKPTDI Sbjct: 129 RDDETMEEWDQETLEKVVESKKNEYNQNKPTDI 161